(data stored in ACNUC7421 zone)

EMBL: CP001700.PE230

CP001700.PE230       Location/Qualifiers
FT   CDS             260978..261880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0232"
FT                   /product="putative metal-dependent hydrolase"
FT                   /note="KEGG: cmi:CMM_0528 putative metal-dependent
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69185"
FT                   /db_xref="GOA:C7QJ43"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ43"
FT                   /inference="similar to AA sequence:KEGG:CMM_0528"
FT                   /protein_id="ACU69185.1"
FT                   /translation="MSDSFCSTVVTFPEGAIEASSTIVHIQRVLGLDPKATHWAVFTEA
FT                   TPFHPVDPTWPDQPGDTGVLLTDVGELPVTGCVTAAVARAGGELLVDAEITAKRGDPEY
FT                   AWLVCHLVADRAGDLPGRLVGTAAKLLVDRRRRRRLSVAHTACHLTGLALNVNLADRWR
FT                   KPIRTDGLGRPDFDGVAIVSSRIAEDGAMDTYRLGTSLRKAGFVSEGFADGVSALQSAI
FT                   ETSVAEWVRQAGQITVLTKGSALHDRRTWECVLQEGTARTSCGGTHPQNTGELGSVTVR
FT                   CAFDPDTKLLTVATTVVPS"
     MSDSFCSTVV TFPEGAIEAS STIVHIQRVL GLDPKATHWA VFTEATPFHP VDPTWPDQPG        60
     DTGVLLTDVG ELPVTGCVTA AVARAGGELL VDAEITAKRG DPEYAWLVCH LVADRAGDLP       120
     GRLVGTAAKL LVDRRRRRRL SVAHTACHLT GLALNVNLAD RWRKPIRTDG LGRPDFDGVA       180
     IVSSRIAEDG AMDTYRLGTS LRKAGFVSEG FADGVSALQS AIETSVAEWV RQAGQITVLT       240
     KGSALHDRRT WECVLQEGTA RTSCGGTHPQ NTGELGSVTV RCAFDPDTKL LTVATTVVPS       300
//

If you have problems or comments...

PBIL Back to PBIL home page