(data stored in ACNUC7421 zone)

EMBL: CP001700.PE232

CP001700.PE232       Location/Qualifiers
FT   CDS             complement(263541..264188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0234"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: sco:SCO5845 thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69187"
FT                   /db_xref="GOA:C7QJ45"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ45"
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /protein_id="ACU69187.1"
FT                   /translation="MAELVFFTGTMDSGKSTLALQLDHNHNARGRAGLIFTRDDRAGSA
FT                   TISSRLGLKAAAVEVGQNTDLLNHVVQLMSAGGKVDYVVADEAQFYTEDHIEQLARMVD
FT                   ELSIDVYAFGITTDFRTRLFPGSKRLIELADRIEVLQVQTLCWCGARATHNARTLGGEM
FT                   VVEGEQVVVGDTAVADEIGYEVLCRRHHRRRLTAARSGAAALSPDTLPFGAA"
     MAELVFFTGT MDSGKSTLAL QLDHNHNARG RAGLIFTRDD RAGSATISSR LGLKAAAVEV        60
     GQNTDLLNHV VQLMSAGGKV DYVVADEAQF YTEDHIEQLA RMVDELSIDV YAFGITTDFR       120
     TRLFPGSKRL IELADRIEVL QVQTLCWCGA RATHNARTLG GEMVVEGEQV VVGDTAVADE       180
     IGYEVLCRRH HRRRLTAARS GAAALSPDTL PFGAA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page