(data stored in ACNUC7421 zone)

EMBL: CP001700.PE233

CP001700.PE233       Location/Qualifiers
FT   CDS             complement(264205..264516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69188"
FT                   /db_xref="GOA:C7QJ46"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69188.1"
FT                   /translation="MIRRSLTALAAAAAAELCCVAGSYLHAIRLVAHVEGVSVWTALNS
FT                   RHNASLTAWRASLTVGDRLLFVAVALVAAAAVLARPYLKPTFGRIRTRITSVRGLPRA"
     MIRRSLTALA AAAAAELCCV AGSYLHAIRL VAHVEGVSVW TALNSRHNAS LTAWRASLTV        60
     GDRLLFVAVA LVAAAAVLAR PYLKPTFGRI RTRITSVRGL PRA                         103
//

If you have problems or comments...

PBIL Back to PBIL home page