(data stored in ACNUC7421 zone)

EMBL: CP001700.PE234

CP001700.PE234       Location/Qualifiers
FT   CDS             complement(264689..265114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0236"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   mmi:MMAR_5292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69189"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ47"
FT                   /inference="protein motif:PFAM:PF01906"
FT                   /protein_id="ACU69189.1"
FT                   /translation="MSQQPYGQPGYQQGPPPQQGQYAPPPQQQGFQQNFLCVTTNDIPG
FT                   YRIDAVYGEVFGLTVRSRNAFSQMGAGLKSMFGGELKGMTKALMDSRNDVMQRMIQEAI
FT                   NRGGNAIVGMRFDTSEMGDVWTEICAYGTAVTISRQG"
     MSQQPYGQPG YQQGPPPQQG QYAPPPQQQG FQQNFLCVTT NDIPGYRIDA VYGEVFGLTV        60
     RSRNAFSQMG AGLKSMFGGE LKGMTKALMD SRNDVMQRMI QEAINRGGNA IVGMRFDTSE       120
     MGDVWTEICA YGTAVTISRQ G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page