(data stored in ACNUC7421 zone)

EMBL: CP001700.PE235

CP001700.PE235       Location/Qualifiers
FT   CDS             265300..266295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0237"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV_4224 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69190"
FT                   /db_xref="GOA:C7QJ48"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ48"
FT                   /inference="protein motif:PRIAM:3.1.4.46"
FT                   /protein_id="ACU69190.1"
FT                   /translation="MHSLRPSEPRPSERRRSEPVSPVRQHAALRTGASGPGLPRRPALE
FT                   IPVIAHRGASDDVPEHTLAAYEAALLQGADGLECDVRLTADMQLVCVHDRRVNRTSNGR
FT                   GVVSTLELAQLRQLDFGSWKQPAAGEEHEYAEYPDLRREGAHRVLTLERLLQLVVEHPH
FT                   RVEMAIETKHPTRYAGLVEEHLVALLDRFGLAHPRLGETSPVRVMSFSAMSVRRIRRLA
FT                   PSLDTVLLLDRVPLRLRDGSLPRGVRIAGPGIHILRIHPEYVERVHSMGNRVHVWTVDQ
FT                   PSDIDLCVELGVDAIISNRPKAVLARLGRDGTAAAAAARHGVVELNPDSP"
     MHSLRPSEPR PSERRRSEPV SPVRQHAALR TGASGPGLPR RPALEIPVIA HRGASDDVPE        60
     HTLAAYEAAL LQGADGLECD VRLTADMQLV CVHDRRVNRT SNGRGVVSTL ELAQLRQLDF       120
     GSWKQPAAGE EHEYAEYPDL RREGAHRVLT LERLLQLVVE HPHRVEMAIE TKHPTRYAGL       180
     VEEHLVALLD RFGLAHPRLG ETSPVRVMSF SAMSVRRIRR LAPSLDTVLL LDRVPLRLRD       240
     GSLPRGVRIA GPGIHILRIH PEYVERVHSM GNRVHVWTVD QPSDIDLCVE LGVDAIISNR       300
     PKAVLARLGR DGTAAAAAAR HGVVELNPDS P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page