(data stored in ACNUC7421 zone)

EMBL: CP001700.PE236

CP001700.PE236       Location/Qualifiers
FT   CDS             266366..267253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0238"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sco:SCO3975 regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69191"
FT                   /db_xref="GOA:C7QJ49"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ49"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69191.1"
FT                   /translation="MGVVMSVQPESPRKSVSLSTTVTRAPAPRPADSRGTGGTEFPYTP
FT                   ESVGTARHALADALQRMRVAPPAADDAVLILSELVSNALRHALPLAGGTIRVAWWMADD
FT                   KVLRIAVTDGGRQQPGQAPPLKAAEAPDLVAPDLDDIDESAVDGRGLGIVGLLADAWGV
FT                   EPWYAPETEATSPYLHAATTSATASAASSAATSRAIHPDPSAPKTVWAAVRLHARHAAP
FT                   PPPDDQDRRWWRRMRLSLTAHLPGTTRPRTRGTRLGGSRLGEARGGPDSDAAGSDTAWV
FT                   PRYPEARVGCAAAG"
     MGVVMSVQPE SPRKSVSLST TVTRAPAPRP ADSRGTGGTE FPYTPESVGT ARHALADALQ        60
     RMRVAPPAAD DAVLILSELV SNALRHALPL AGGTIRVAWW MADDKVLRIA VTDGGRQQPG       120
     QAPPLKAAEA PDLVAPDLDD IDESAVDGRG LGIVGLLADA WGVEPWYAPE TEATSPYLHA       180
     ATTSATASAA SSAATSRAIH PDPSAPKTVW AAVRLHARHA APPPPDDQDR RWWRRMRLSL       240
     TAHLPGTTRP RTRGTRLGGS RLGEARGGPD SDAAGSDTAW VPRYPEARVG CAAAG            295
//

If you have problems or comments...

PBIL Back to PBIL home page