(data stored in ACNUC7421 zone)

EMBL: CP001700.PE237

CP001700.PE237       Location/Qualifiers
FT   CDS             complement(267790..269736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0239"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; Chorismate
FT                   binding-like; KEGG: stp:Strop_2960 glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69192"
FT                   /db_xref="GOA:C7QJ50"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ50"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ACU69192.1"
FT                   /translation="MPHQGQGQDTLTSPSPSLPDGPFALIRRGVEAEVELLTGQAFEQF
FT                   PALADLPTEDSDALLALVPYRQLTERGDECHDDHAPLLAMRITERRRFGIAQLPPATPP
FT                   VLRDGAFDVDDEAYGASVKRVLDEEIGAGEGSNFVLRRTFVGHCDSARETAYGAFCALL
FT                   EKERNAYWTFLIDTGEGFMVGATPERHVSLADGVAVMNPISGTLREAPATASRERVLAF
FT                   LQDAKEREELAMVVDEELKMLAEVGDLGGRVRGPFLKEMANLAHTEYYIEARTTMDPRL
FT                   ILRTTMFAPTATGSPIRNAFRVIKRHERGGRGYYAGVAALIGRDEAGAPTMDAPLLLRV
FT                   AYVENDGTVRVPVGATLVRGSDPYEEVRETYAKAAGVLRAFGVGFGARGGLAVGTEVAP
FT                   LGGSDAAAASVTPAPLSAPDATPIRTTPWSEDPEIAALLSARNESLSGFWLNEHEPADL
FT                   VDPQLAGRKVLIVDNEDAFTSMLAVELRALGLETTRVSHDEVPDHTTYDLVLLGPGPGD
FT                   PRDTASPRMTSVRTLAKLLIDHRVPTLGLCLGHEALAAALGLELVRLPTPMQGTQVELD
FT                   LFGTTERVAFYNSYAARKPEFLVLDTVLLPGTTLTAALRGPSFTGLQFHPESVVTMDGL
FT                   GILSREIRRLLTR"
     MPHQGQGQDT LTSPSPSLPD GPFALIRRGV EAEVELLTGQ AFEQFPALAD LPTEDSDALL        60
     ALVPYRQLTE RGDECHDDHA PLLAMRITER RRFGIAQLPP ATPPVLRDGA FDVDDEAYGA       120
     SVKRVLDEEI GAGEGSNFVL RRTFVGHCDS ARETAYGAFC ALLEKERNAY WTFLIDTGEG       180
     FMVGATPERH VSLADGVAVM NPISGTLREA PATASRERVL AFLQDAKERE ELAMVVDEEL       240
     KMLAEVGDLG GRVRGPFLKE MANLAHTEYY IEARTTMDPR LILRTTMFAP TATGSPIRNA       300
     FRVIKRHERG GRGYYAGVAA LIGRDEAGAP TMDAPLLLRV AYVENDGTVR VPVGATLVRG       360
     SDPYEEVRET YAKAAGVLRA FGVGFGARGG LAVGTEVAPL GGSDAAAASV TPAPLSAPDA       420
     TPIRTTPWSE DPEIAALLSA RNESLSGFWL NEHEPADLVD PQLAGRKVLI VDNEDAFTSM       480
     LAVELRALGL ETTRVSHDEV PDHTTYDLVL LGPGPGDPRD TASPRMTSVR TLAKLLIDHR       540
     VPTLGLCLGH EALAAALGLE LVRLPTPMQG TQVELDLFGT TERVAFYNSY AARKPEFLVL       600
     DTVLLPGTTL TAALRGPSFT GLQFHPESVV TMDGLGILSR EIRRLLTR                    648
//

If you have problems or comments...

PBIL Back to PBIL home page