(data stored in ACNUC7421 zone)

EMBL: CP001700.PE238

CP001700.PE238       Location/Qualifiers
FT   CDS             270018..271001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0240"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV_4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69193"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ51"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU69193.1"
FT                   /translation="MGKKSSRTAKAGPAKAVDGEIPVVGAREACPCGSGRRYKACHGRE
FT                   AAAAAHQQAAEVTANKRPFEGLPGEADIVAMRELVPAATAPLKLAGEHADRTVTLATVL
FT                   PMAAPAVHRDTGEIMLALQTLATSGDPDRDLADALLRALDSAPGTVVDSAAPAADGPRL
FT                   RDLLDTSGDSLGITVHEDFSFWIIDGADVSPEAQLSLEHANAAAYPTKKLESVPSAYWT
FT                   RIREKGHLRWVMPHEEEKLMDALARLHAAKQSNLGEGTRYVGAFRACGLVVPVWDLPKE
FT                   MEAAEIEKPAAEFAERLAKALTDDSPLTNDQRRARAGLVSRQVTLR"
     MGKKSSRTAK AGPAKAVDGE IPVVGAREAC PCGSGRRYKA CHGREAAAAA HQQAAEVTAN        60
     KRPFEGLPGE ADIVAMRELV PAATAPLKLA GEHADRTVTL ATVLPMAAPA VHRDTGEIML       120
     ALQTLATSGD PDRDLADALL RALDSAPGTV VDSAAPAADG PRLRDLLDTS GDSLGITVHE       180
     DFSFWIIDGA DVSPEAQLSL EHANAAAYPT KKLESVPSAY WTRIREKGHL RWVMPHEEEK       240
     LMDALARLHA AKQSNLGEGT RYVGAFRACG LVVPVWDLPK EMEAAEIEKP AAEFAERLAK       300
     ALTDDSPLTN DQRRARAGLV SRQVTLR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page