(data stored in ACNUC7421 zone)

EMBL: CP001700.PE239

CP001700.PE239       Location/Qualifiers
FT   CDS             complement(271124..272263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69194"
FT                   /db_xref="GOA:C7QJ52"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69194.1"
FT                   /translation="MAGMALSRTVRPRALALLPAVAAGGAALVGAGLPTSAAAAAAAAS
FT                   HAAASTLITVTVDSVPALSLNAFQGSYATSTLAQNAGDGSADGAQDPNGVLDRITLDQP
FT                   TQSKIHSDPAKNWADAQPAVEYTLHGKKLYAVSSVDAHAECTPSGQGVNTYVHTAPNSV
FT                   TVLGTNVGAGKTTMAVTGAQLGVAGVDHGSLDVSYTTTATQGQQAAGTSARAHMDLTIS
FT                   GVFYDSQGKQLYSGQLQKLRLGDVQVACQNSGTTTPAPTPTTAVTVASSSGGSVDGVGD
FT                   PTAPGPAAPSTLKGEPDPAAYMRSPHQAGQNGQVRGNAKDEMGPAVPENGPVLPAENAA
FT                   KSSTSGGSDGSLWWALLSVLGLGGGTALYFATRRRGRHQ"
     MAGMALSRTV RPRALALLPA VAAGGAALVG AGLPTSAAAA AAAASHAAAS TLITVTVDSV        60
     PALSLNAFQG SYATSTLAQN AGDGSADGAQ DPNGVLDRIT LDQPTQSKIH SDPAKNWADA       120
     QPAVEYTLHG KKLYAVSSVD AHAECTPSGQ GVNTYVHTAP NSVTVLGTNV GAGKTTMAVT       180
     GAQLGVAGVD HGSLDVSYTT TATQGQQAAG TSARAHMDLT ISGVFYDSQG KQLYSGQLQK       240
     LRLGDVQVAC QNSGTTTPAP TPTTAVTVAS SSGGSVDGVG DPTAPGPAAP STLKGEPDPA       300
     AYMRSPHQAG QNGQVRGNAK DEMGPAVPEN GPVLPAENAA KSSTSGGSDG SLWWALLSVL       360
     GLGGGTALYF ATRRRGRHQ                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page