(data stored in ACNUC7421 zone)

EMBL: CP001700.PE24

CP001700.PE24        Location/Qualifiers
FT   CDS             24904..26529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0024"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO5516 integral membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68979"
FT                   /db_xref="GOA:C7QFP0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU68979.1"
FT                   /translation="MTTTQNPGTAPAPRAGRKEWIGLAVLVLPCLLISMDMSVLLFGLP
FT                   FISASLKPSATQQLWIMDAYGFALAGLLITMGAVGDRIGRRRLLLIGATAFGAASVVAA
FT                   YSGSAEVLIGTRALLGVAGATLMPSTMALIRNMFHDPKQRQTAISLWTGGLIGGVTLGP
FT                   IVGGALLNHFWWGSVFLINLPAMALLLILGPLLLPEYKAPADGRRFDVLGSVLSMAAVF
FT                   PAVYGIKQLAVDGFSATAAGSLAFGIALAVAFVLRQHTAKNPLIDMELFRKPAFRAPML
FT                   VNLCGNFVLMGFSLFNTQYLQSVAGMRPFTAALWSMAAMPFVSVGMGVTGALTTKVRPG
FT                   RIIGVAFLVSSAGALVLTLAHPGNPIVVLLIGAGIAAGGVVAAQSIVGNMVMAAAPAER
FT                   AGSASALNETGAELGSSLGMALLGSVGAAIYHHKMQTVGASGAPDAAVRAGHETIGGAD
FT                   ALAAQFPGPATHALLTTARDAYASGLHTAAGVGAVVLFLTALFAFRALRNEPVLPAAPK
FT                   KEKGTKSKDAMPAEISPDYAAQAV"
     MTTTQNPGTA PAPRAGRKEW IGLAVLVLPC LLISMDMSVL LFGLPFISAS LKPSATQQLW        60
     IMDAYGFALA GLLITMGAVG DRIGRRRLLL IGATAFGAAS VVAAYSGSAE VLIGTRALLG       120
     VAGATLMPST MALIRNMFHD PKQRQTAISL WTGGLIGGVT LGPIVGGALL NHFWWGSVFL       180
     INLPAMALLL ILGPLLLPEY KAPADGRRFD VLGSVLSMAA VFPAVYGIKQ LAVDGFSATA       240
     AGSLAFGIAL AVAFVLRQHT AKNPLIDMEL FRKPAFRAPM LVNLCGNFVL MGFSLFNTQY       300
     LQSVAGMRPF TAALWSMAAM PFVSVGMGVT GALTTKVRPG RIIGVAFLVS SAGALVLTLA       360
     HPGNPIVVLL IGAGIAAGGV VAAQSIVGNM VMAAAPAERA GSASALNETG AELGSSLGMA       420
     LLGSVGAAIY HHKMQTVGAS GAPDAAVRAG HETIGGADAL AAQFPGPATH ALLTTARDAY       480
     ASGLHTAAGV GAVVLFLTAL FAFRALRNEP VLPAAPKKEK GTKSKDAMPA EISPDYAAQA       540
     V                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page