(data stored in ACNUC7421 zone)

EMBL: CP001700.PE241

CP001700.PE241       Location/Qualifiers
FT   CDS             273093..273794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0243"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   kra:Krad_0170 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69196"
FT                   /db_xref="GOA:C7QJ54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ54"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU69196.1"
FT                   /translation="MEAEPVTEVTSSDVFVIIPAWNEQERIAATVRAAAALGPVLVMDD
FT                   GSRDATTRIARRAGARVLTTRNNLGKGAAMAAGVAALPQQARYVLFLDADLEDTASQAG
FT                   PLVDAVRSGSCDMAIALPPPQPGGGHGLVVGLAREGIKRLTGFDAAAPLSGQRCLTREA
FT                   AEAVRYAARFGVEVGLTIDLLRAGYEVAEVPADLRHRVTGEDWRSQIHRARQYRDVLLA
FT                   LRSRSLPPRSP"
     MEAEPVTEVT SSDVFVIIPA WNEQERIAAT VRAAAALGPV LVMDDGSRDA TTRIARRAGA        60
     RVLTTRNNLG KGAAMAAGVA ALPQQARYVL FLDADLEDTA SQAGPLVDAV RSGSCDMAIA       120
     LPPPQPGGGH GLVVGLAREG IKRLTGFDAA APLSGQRCLT REAAEAVRYA ARFGVEVGLT       180
     IDLLRAGYEV AEVPADLRHR VTGEDWRSQI HRARQYRDVL LALRSRSLPP RSP              233
//

If you have problems or comments...

PBIL Back to PBIL home page