(data stored in ACNUC7421 zone)

EMBL: CP001700.PE242

CP001700.PE242       Location/Qualifiers
FT   CDS             complement(273760..274083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0244"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: sma:SAV_4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69197"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ55"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU69197.1"
FT                   /translation="MLATTDVNALPEGGLLLDVREDDEWAAGHAPTAQHIPMSEFAARK
FT                   DELGTPEGPVYVICRAGSRSAQVAQYLSQNGVEAVNVTGGMQAWEAAGKAVVTDSGAAG
FT                   IVI"
     MLATTDVNAL PEGGLLLDVR EDDEWAAGHA PTAQHIPMSE FAARKDELGT PEGPVYVICR        60
     AGSRSAQVAQ YLSQNGVEAV NVTGGMQAWE AAGKAVVTDS GAAGIVI                     107
//

If you have problems or comments...

PBIL Back to PBIL home page