(data stored in ACNUC7421 zone)

EMBL: CP001700.PE243

CP001700.PE243       Location/Qualifiers
FT   CDS             274186..275463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0245"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: sco:SCO3961 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69198"
FT                   /db_xref="GOA:C7QJ56"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ56"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU69198.1"
FT                   /translation="MIDLRLLRTDPERVRASQRARGEDPALVDALLSADEARRAAVSRF
FT                   DTLRNEQKVLGKQIPKAAGEEKAALLEQAKKLADGVKAAEADQHEADDVLKQLQLSLSN
FT                   VVIDGVPEGGEDDFVLRETVGTPRDFAADGFEPRDHVELGKLLGAIDLERGVKVGGARQ
FT                   YYLTGVGALLEIALLNMAMAQATTYGFTPMITPSLVKPEAMAGTGFLGQAAENVYHLTE
FT                   DDMYLVGTSEVPLAAYHMDEILDAAKLPLRYAGYSSCYRREAGSYGKDTRGIIRVHQFE
FT                   KVEMFSYVLPEEAEAEHLRLLGWEKEFLTALEIPFRVIDVAAGDLGSSAARKYDCEAWI
FT                   PTQGKYREVTSTSNCTEFQARRLQIRMRGADGVKPLATLNGTLCAMTRMIVAILENHQN
FT                   ADGSVTVPAALRPYLGGREKLEPVAG"
     MIDLRLLRTD PERVRASQRA RGEDPALVDA LLSADEARRA AVSRFDTLRN EQKVLGKQIP        60
     KAAGEEKAAL LEQAKKLADG VKAAEADQHE ADDVLKQLQL SLSNVVIDGV PEGGEDDFVL       120
     RETVGTPRDF AADGFEPRDH VELGKLLGAI DLERGVKVGG ARQYYLTGVG ALLEIALLNM       180
     AMAQATTYGF TPMITPSLVK PEAMAGTGFL GQAAENVYHL TEDDMYLVGT SEVPLAAYHM       240
     DEILDAAKLP LRYAGYSSCY RREAGSYGKD TRGIIRVHQF EKVEMFSYVL PEEAEAEHLR       300
     LLGWEKEFLT ALEIPFRVID VAAGDLGSSA ARKYDCEAWI PTQGKYREVT STSNCTEFQA       360
     RRLQIRMRGA DGVKPLATLN GTLCAMTRMI VAILENHQNA DGSVTVPAAL RPYLGGREKL       420
     EPVAG                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page