(data stored in ACNUC7421 zone)

EMBL: CP001700.PE244

CP001700.PE244       Location/Qualifiers
FT   CDS             complement(275522..276583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69199"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69199.1"
FT                   /translation="METENPDTGRMHQLFGAALDDVDLTGDVVPNVLTGYAHKVKVRRY
FT                   QGAGVAVAALAAAGIAVNVLPHGTGGAPPTTSSATPVQQSPDYCQHQQWVRVSAGVVVQ
FT                   NGNVPLAIPLSPDPRADQASCDALQKALHAVFPEARLIPAFNPDLTRDPRLDQARVRTI
FT                   EMEETTDPNKWSADLTKYFGSELTRLAAHPEDPVNVYMPGQYTLVTPGVRESFGVAFVT
FT                   AAPVANAPESFVGSVGSEDCEKMPAALKDKDQCTSVGVSAGWHGALWNTPAQGVNAPEQ
FT                   TVVLTNGSGTRFQLNAHGTDDSARGIAPSGNALTDEQWARLVASPALQKYADDYFGKAP
FT                   VVPHSTPSPTHSR"
     METENPDTGR MHQLFGAALD DVDLTGDVVP NVLTGYAHKV KVRRYQGAGV AVAALAAAGI        60
     AVNVLPHGTG GAPPTTSSAT PVQQSPDYCQ HQQWVRVSAG VVVQNGNVPL AIPLSPDPRA       120
     DQASCDALQK ALHAVFPEAR LIPAFNPDLT RDPRLDQARV RTIEMEETTD PNKWSADLTK       180
     YFGSELTRLA AHPEDPVNVY MPGQYTLVTP GVRESFGVAF VTAAPVANAP ESFVGSVGSE       240
     DCEKMPAALK DKDQCTSVGV SAGWHGALWN TPAQGVNAPE QTVVLTNGSG TRFQLNAHGT       300
     DDSARGIAPS GNALTDEQWA RLVASPALQK YADDYFGKAP VVPHSTPSPT HSR              353
//

If you have problems or comments...

PBIL Back to PBIL home page