(data stored in ACNUC7421 zone)

EMBL: CP001700.PE246

CP001700.PE246       Location/Qualifiers
FT   CDS             complement(277219..278541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0248"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sgr:SGR_1492 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69201"
FT                   /db_xref="GOA:C7QJ59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ59"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69201.1"
FT                   /translation="MRTIINRDFTRLWYGEAVSEVGDYVFNTTLVLWIATKLGNGKSWA
FT                   PVAVSGVLLSGLAATLAIAPAAGVFADRWNRKRTMLRMDAIRAVAVGGLAALAFLPAGK
FT                   LPVGVWLAIIYAVVFVINAAGTFFGPSRMAVIPDVVGGPDEIARASGITQSTAALAGMI
FT                   GPPLAAPLLFAGGVQWAMLINALSYVVSFTAIRPVPIPGNAPSPAAKAESGFWSEFRAV
FT                   LAFFAKTRVLVVLIISACIANFGAQAMNTLDVFFATRNLHAAPKLYGLLGMAIGAGAII
FT                   GALLSTRVVRRIGTVNAVWATIGTAGVLIVAYSRQTSIWAAIPVIFLASLPIAMVNTAM
FT                   EPLLIQVTPRAMLGRVFSVITPAISVTQLGSTILFGWMISSLMLHFHADVAGLHVGPID
FT                   TLFTVTGLLFVVAAIYAFVMLPRKDGVPAAEPDDEGELALV"
     MRTIINRDFT RLWYGEAVSE VGDYVFNTTL VLWIATKLGN GKSWAPVAVS GVLLSGLAAT        60
     LAIAPAAGVF ADRWNRKRTM LRMDAIRAVA VGGLAALAFL PAGKLPVGVW LAIIYAVVFV       120
     INAAGTFFGP SRMAVIPDVV GGPDEIARAS GITQSTAALA GMIGPPLAAP LLFAGGVQWA       180
     MLINALSYVV SFTAIRPVPI PGNAPSPAAK AESGFWSEFR AVLAFFAKTR VLVVLIISAC       240
     IANFGAQAMN TLDVFFATRN LHAAPKLYGL LGMAIGAGAI IGALLSTRVV RRIGTVNAVW       300
     ATIGTAGVLI VAYSRQTSIW AAIPVIFLAS LPIAMVNTAM EPLLIQVTPR AMLGRVFSVI       360
     TPAISVTQLG STILFGWMIS SLMLHFHADV AGLHVGPIDT LFTVTGLLFV VAAIYAFVML       420
     PRKDGVPAAE PDDEGELALV                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page