(data stored in ACNUC7421 zone)

EMBL: CP001700.PE247

CP001700.PE247       Location/Qualifiers
FT   CDS             278772..280166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0249"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69202"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ60"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69202.1"
FT                   /translation="MKRRTSSLLTAIALVSGAAASTLAVAPAQAATDSGTCASGSEKQG
FT                   PISFNPSAAVAPATIGIRVAANTIDAANGCKAVLDFGDGTSTALSTDADVAHTYTNPGD
FT                   YRVTLTLQWPGYSPAVESGHLLIGGAAGQAQITRIAGADRLDTAVQISQKQWLTVDPKS
FT                   SWGQAQTAVIATSGTFPDALAGGPLAAYKRGPLLLTPPNAGLYGAANDEINRVVPKGRT
FT                   IFILGGYAAVSASVDQQLITEGYKVQRFAGQTRFDTALQVAKFGLGDPANVVVATGTDF
FT                   PDALSAGPLAAGPRATEVAGQAPQPAAIILTNGAKFFDPSTSAYVKGKLGTANCNAVTA
FT                   VGGAAVHALGALAGGLCHSELSGADRYATSAKVFGEFSLTYLVGVASGTTFADALTGAA
FT                   YVANVQQPLLLTDPTHLPDPIGAYFDAMGKQAGISYVDVFGGPKAITDHVYGQIADAAH
FT                   SGEYNP"
     MKRRTSSLLT AIALVSGAAA STLAVAPAQA ATDSGTCASG SEKQGPISFN PSAAVAPATI        60
     GIRVAANTID AANGCKAVLD FGDGTSTALS TDADVAHTYT NPGDYRVTLT LQWPGYSPAV       120
     ESGHLLIGGA AGQAQITRIA GADRLDTAVQ ISQKQWLTVD PKSSWGQAQT AVIATSGTFP       180
     DALAGGPLAA YKRGPLLLTP PNAGLYGAAN DEINRVVPKG RTIFILGGYA AVSASVDQQL       240
     ITEGYKVQRF AGQTRFDTAL QVAKFGLGDP ANVVVATGTD FPDALSAGPL AAGPRATEVA       300
     GQAPQPAAII LTNGAKFFDP STSAYVKGKL GTANCNAVTA VGGAAVHALG ALAGGLCHSE       360
     LSGADRYATS AKVFGEFSLT YLVGVASGTT FADALTGAAY VANVQQPLLL TDPTHLPDPI       420
     GAYFDAMGKQ AGISYVDVFG GPKAITDHVY GQIADAAHSG EYNP                        464
//

If you have problems or comments...

PBIL Back to PBIL home page