(data stored in ACNUC7421 zone)

EMBL: CP001700.PE248

CP001700.PE248       Location/Qualifiers
FT   CDS             complement(280193..281374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0250"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: saq:Sare_0997 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69203"
FT                   /db_xref="GOA:C7QJ61"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ61"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ACU69203.1"
FT                   /translation="MGSSVTSTLLTGIAELTTHADSGGLADSTVADAAMVVVDGRVAWT
FT                   GPGAGAPDADERVELGGRAVIPGFVDSHAHLVFAGDRAQEFAARMTGAPYSAGGIRTTV
FT                   AATRGASDDVLRSNLRRLVGEMLRQGTTTVECKSGYGLTVEDEARALRLAREQVEAVTY
FT                   LGAHVVPAEYKDRAGEYVDLVKGPMLDACAPYADFADVFCERGAFDEEQTREILTAARA
FT                   KGLDLRLHANQLGNGPGVQLAVEFGAASADHCTFLDDKDIDALAGSQTIATLLPGVEFS
FT                   TRSPYPDARRLLDAGATVAIATDCNPGSCYTNSMPFCIAVAVRDMHMSPAEALWAATVG
FT                   GAKALRRDDVGHLGVGARADFAVLDAPSYLHLAYRPGVPLVHRVWKNGTPVAG"
     MGSSVTSTLL TGIAELTTHA DSGGLADSTV ADAAMVVVDG RVAWTGPGAG APDADERVEL        60
     GGRAVIPGFV DSHAHLVFAG DRAQEFAARM TGAPYSAGGI RTTVAATRGA SDDVLRSNLR       120
     RLVGEMLRQG TTTVECKSGY GLTVEDEARA LRLAREQVEA VTYLGAHVVP AEYKDRAGEY       180
     VDLVKGPMLD ACAPYADFAD VFCERGAFDE EQTREILTAA RAKGLDLRLH ANQLGNGPGV       240
     QLAVEFGAAS ADHCTFLDDK DIDALAGSQT IATLLPGVEF STRSPYPDAR RLLDAGATVA       300
     IATDCNPGSC YTNSMPFCIA VAVRDMHMSP AEALWAATVG GAKALRRDDV GHLGVGARAD       360
     FAVLDAPSYL HLAYRPGVPL VHRVWKNGTP VAG                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page