(data stored in ACNUC7421 zone)

EMBL: CP001700.PE249

CP001700.PE249       Location/Qualifiers
FT   CDS             complement(281646..283079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0251"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: sma:SAV_3494 N-formimino-L-glutamate
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69204"
FT                   /db_xref="GOA:C7QJ62"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ62"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACU69204.1"
FT                   /translation="MTSSENPQTATTIPATTPSPNGGAASAGADRRAFWCELAWINGEI
FT                   KSKVLIEVAGGQISAVTCGVKPRPQNAEKLTGLTIPGLANVHSHAFHRALRGRTQIESG
FT                   TFWTWRERMYAAAAHLDPDSYRELATAVFAEMALAGVTAVGEFHYVHHSPKGGLYQDPN
FT                   AMGHALTEAAEAAGIRITLLDTCYLSGGFDNELNDVQRRFSDGDAGRWAERVEALRKAY
FT                   AGSDTVRIGAAVHSVRAVPVDQLSPVVAFAAENEMPLHVHLSEQRAENDACLARHHKTP
FT                   TELLHAHGALGPRTTAVHATHLSQMDIDLLGTSATAVCMCPTTERDLADGIGPAHAVHL
FT                   AGSPVNLGTDSHAMIDLFEEARAVELDERLRTERRGHWLASELLQAATTDGHASLGWPT
FT                   TGRLQPGTPADFTTIALDTVRLAGVQPAHAAESVIFAATAADVRHVVVAGKFTVRDHQH
FT                   MLVDDVPGRLAATIGAIFK"
     MTSSENPQTA TTIPATTPSP NGGAASAGAD RRAFWCELAW INGEIKSKVL IEVAGGQISA        60
     VTCGVKPRPQ NAEKLTGLTI PGLANVHSHA FHRALRGRTQ IESGTFWTWR ERMYAAAAHL       120
     DPDSYRELAT AVFAEMALAG VTAVGEFHYV HHSPKGGLYQ DPNAMGHALT EAAEAAGIRI       180
     TLLDTCYLSG GFDNELNDVQ RRFSDGDAGR WAERVEALRK AYAGSDTVRI GAAVHSVRAV       240
     PVDQLSPVVA FAAENEMPLH VHLSEQRAEN DACLARHHKT PTELLHAHGA LGPRTTAVHA       300
     THLSQMDIDL LGTSATAVCM CPTTERDLAD GIGPAHAVHL AGSPVNLGTD SHAMIDLFEE       360
     ARAVELDERL RTERRGHWLA SELLQAATTD GHASLGWPTT GRLQPGTPAD FTTIALDTVR       420
     LAGVQPAHAA ESVIFAATAA DVRHVVVAGK FTVRDHQHML VDDVPGRLAA TIGAIFK          477
//

If you have problems or comments...

PBIL Back to PBIL home page