(data stored in ACNUC7421 zone)

EMBL: CP001700.PE25

CP001700.PE25        Location/Qualifiers
FT   CDS             complement(26620..27483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0025"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; KEGG: kpn:KPN_04605 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68980"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU68980.1"
FT                   /translation="MTIAITAAGGHLGRLVVEDLLARGVPAGQIRAIVRTPEKVQDFAD
FT                   RGVQVVRGDYADVPGLTEALRGADKWVFISSSGSDEDRLSQHLTAIQAGKAAGVPHVVY
FT                   TSIPKAETNPISFASVHKETEAAIKESGLPHTFLRNNWYWENLTASLPNAIEHGAIIGA
FT                   VGEGLTAFAARADYAAAAAVVATTEGHEGKIYELTGDRAYSYAEIAAEISRQTGKEIAA
FT                   VNLDPEEYRKTLAGFGLPDFLSAGLAHADSKIAEGALADVTSDLSTLIGRPTTTVAEAI
FT                   TDALKA"
     MTIAITAAGG HLGRLVVEDL LARGVPAGQI RAIVRTPEKV QDFADRGVQV VRGDYADVPG        60
     LTEALRGADK WVFISSSGSD EDRLSQHLTA IQAGKAAGVP HVVYTSIPKA ETNPISFASV       120
     HKETEAAIKE SGLPHTFLRN NWYWENLTAS LPNAIEHGAI IGAVGEGLTA FAARADYAAA       180
     AAVVATTEGH EGKIYELTGD RAYSYAEIAA EISRQTGKEI AAVNLDPEEY RKTLAGFGLP       240
     DFLSAGLAHA DSKIAEGALA DVTSDLSTLI GRPTTTVAEA ITDALKA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page