(data stored in ACNUC7421 zone)

EMBL: CP001700.PE250

CP001700.PE250       Location/Qualifiers
FT   CDS             complement(283076..284329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0252"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: sgr:SGR_4463 M20/M25/M40 family peptidase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69205"
FT                   /db_xref="GOA:C7QJ63"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ63"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ACU69205.1"
FT                   /translation="MSLFSVHRAVDEAEASAYSDMWRSLLPLGLNSDTGGYRRFAWNTA
FT                   DLACRDWFRSEAAARGLEVETDRNGNLWAWWGPKGPGAIVTGSHLDSVPDGGAFDGPLG
FT                   VVSSFAAVDVLRARGFTPAKPFAVACFSDEEGARFGIACAGSRLMTGALSAEKARGLCD
FT                   LDGVTMASAMEQAGQDPATLGRDDERLEGIAAYVELHVEQGKALAFTESPVAVASAIWP
FT                   HSRWRFEFAGEANHAGTTRLEDRRDPMLTYANAVLAARKKAKLGGAVATFGRLVVEPNG
FT                   TNAIPSRVRAWLDVRAPADEILAAVTEEIIKAADERAGRDGTVLSTERESHTPVVEFDD
FT                   VLRNRLAGSLRQTFGAVPVLPTGAGHDAGILAAAVPTAMLYVRNPTGVSHAPGEHADDR
FT                   DCLAGVTALADVLQELCQ"
     MSLFSVHRAV DEAEASAYSD MWRSLLPLGL NSDTGGYRRF AWNTADLACR DWFRSEAAAR        60
     GLEVETDRNG NLWAWWGPKG PGAIVTGSHL DSVPDGGAFD GPLGVVSSFA AVDVLRARGF       120
     TPAKPFAVAC FSDEEGARFG IACAGSRLMT GALSAEKARG LCDLDGVTMA SAMEQAGQDP       180
     ATLGRDDERL EGIAAYVELH VEQGKALAFT ESPVAVASAI WPHSRWRFEF AGEANHAGTT       240
     RLEDRRDPML TYANAVLAAR KKAKLGGAVA TFGRLVVEPN GTNAIPSRVR AWLDVRAPAD       300
     EILAAVTEEI IKAADERAGR DGTVLSTERE SHTPVVEFDD VLRNRLAGSL RQTFGAVPVL       360
     PTGAGHDAGI LAAAVPTAML YVRNPTGVSH APGEHADDRD CLAGVTALAD VLQELCQ          417
//

If you have problems or comments...

PBIL Back to PBIL home page