(data stored in ACNUC7421 zone)

EMBL: CP001700.PE251

CP001700.PE251       Location/Qualifiers
FT   CDS             complement(284332..286002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0253"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: sco:SCO3073 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69206"
FT                   /db_xref="GOA:C7QJ64"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ64"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACU69206.1"
FT                   /translation="MTATSGPRPVRAARGTSITAQGWQQEAALRMLMNNLDPEVAEHPD
FT                   ELVVYGGTGKAARNWPSFDAMVRTLQTLKNDETMLVQSGKPVGVMQTHEWAPRVLLANS
FT                   NLVGDWANWEEFRRLDALGLTMYGQMTAGSWIYIGTQGILQGTYETFAAVAAKKFNDTL
FT                   AGTITLTAGLGGMGGAQPLAVTMNGGVAICVDCDERSIDRRVEHRYLDVKANSLDHALQ
FT                   LATEARDKREALSIGVLGNAAELVPRLLAMDAPIDIVTDQTSAHDPLAYLPLGMDFHDM
FT                   KQFAKDKPAEFTQRARESMAKHVEAMVGFQDKGAEVFDYGNSIRGEAQLAGYTRAFDFP
FT                   GFVPAYIRPLFCEGKGPFRWAALSGEASDIAKTDKAILELFPENESLARWIKMAGERVH
FT                   FQGLPARICWLGYGERDKAGARFNDMVADGTLAAPIVIGRDHLDAGSVASPYRETEAMA
FT                   DGSDAIADWPLLNAMVNVASGASWVSIHHGGGVGMGRSIHAGQVTVADGTKLAGEKVRR
FT                   VLTNDPGMGVIRHVDAGYDRADEVADERGVRVPMREGDA"
     MTATSGPRPV RAARGTSITA QGWQQEAALR MLMNNLDPEV AEHPDELVVY GGTGKAARNW        60
     PSFDAMVRTL QTLKNDETML VQSGKPVGVM QTHEWAPRVL LANSNLVGDW ANWEEFRRLD       120
     ALGLTMYGQM TAGSWIYIGT QGILQGTYET FAAVAAKKFN DTLAGTITLT AGLGGMGGAQ       180
     PLAVTMNGGV AICVDCDERS IDRRVEHRYL DVKANSLDHA LQLATEARDK REALSIGVLG       240
     NAAELVPRLL AMDAPIDIVT DQTSAHDPLA YLPLGMDFHD MKQFAKDKPA EFTQRARESM       300
     AKHVEAMVGF QDKGAEVFDY GNSIRGEAQL AGYTRAFDFP GFVPAYIRPL FCEGKGPFRW       360
     AALSGEASDI AKTDKAILEL FPENESLARW IKMAGERVHF QGLPARICWL GYGERDKAGA       420
     RFNDMVADGT LAAPIVIGRD HLDAGSVASP YRETEAMADG SDAIADWPLL NAMVNVASGA       480
     SWVSIHHGGG VGMGRSIHAG QVTVADGTKL AGEKVRRVLT NDPGMGVIRH VDAGYDRADE       540
     VADERGVRVP MREGDA                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page