(data stored in ACNUC7421 zone)

EMBL: CP001700.PE252

CP001700.PE252       Location/Qualifiers
FT   CDS             286093..287646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0254"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: sma:SAV_3325 histidine ammonia-lyase; TIGRFAM:
FT                   histidine ammonia-lyase; PFAM: phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69207"
FT                   /db_xref="GOA:C7QJ65"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ65"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACU69207.1"
FT                   /translation="MSQVVVIGEADLTFGDVVAVARDGARVELSATSLKALAEGRAVVD
FT                   RLAAAPTPAYGISTGFGALATRHIDPEMRAQLQRSLIRSHAAGMGPLVEPEVIRALTLM
FT                   RLKTLATGHTGVRPVVAETMAALLNSGVTPAVREYGSLGCSGDLAPLSHVALVLMGEGE
FT                   VVGADGVSAVAAGPVLAEHGIEPLELAPKEGLALINGTDGMLGMLILALGDLTELVKVA
FT                   DISAAMSVEALLGTDKVFRPELQAIRPHPGQAASAANLVKVLDGSPIMESHREPNECTR
FT                   VQDAYSLRCAPQVAGATRDTMAHAATVAERELASIVDNPVVLLADGRVESNGNFHGAPV
FT                   AMVLDFLAIAAADLGSIAERRTDRMLDVARSHGLPPFLADDPGVDSGLMIAQYTQAALV
FT                   SENKRLAVPASVDSIPSSAMQEDHVSMGWSAARKLRTAVDNLRRILAVELVAAARALEL
FT                   RAPLQPAAGTGAAVRALREAGVGGPGPDRFLSPELRAAEDALKSGAVVAAVETAVGPLN
FT                   "
     MSQVVVIGEA DLTFGDVVAV ARDGARVELS ATSLKALAEG RAVVDRLAAA PTPAYGISTG        60
     FGALATRHID PEMRAQLQRS LIRSHAAGMG PLVEPEVIRA LTLMRLKTLA TGHTGVRPVV       120
     AETMAALLNS GVTPAVREYG SLGCSGDLAP LSHVALVLMG EGEVVGADGV SAVAAGPVLA       180
     EHGIEPLELA PKEGLALING TDGMLGMLIL ALGDLTELVK VADISAAMSV EALLGTDKVF       240
     RPELQAIRPH PGQAASAANL VKVLDGSPIM ESHREPNECT RVQDAYSLRC APQVAGATRD       300
     TMAHAATVAE RELASIVDNP VVLLADGRVE SNGNFHGAPV AMVLDFLAIA AADLGSIAER       360
     RTDRMLDVAR SHGLPPFLAD DPGVDSGLMI AQYTQAALVS ENKRLAVPAS VDSIPSSAMQ       420
     EDHVSMGWSA ARKLRTAVDN LRRILAVELV AAARALELRA PLQPAAGTGA AVRALREAGV       480
     GGPGPDRFLS PELRAAEDAL KSGAVVAAVE TAVGPLN                                517
//

If you have problems or comments...

PBIL Back to PBIL home page