(data stored in ACNUC7421 zone)

EMBL: CP001700.PE254

CP001700.PE254       Location/Qualifiers
FT   CDS             288182..288544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69209"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69209.1"
FT                   /translation="MVVDGGAEGVGDASSVGGGELSVVEAVVEPEADADFEVDVEAAPL
FT                   LVLLLVLVLVAGFAGDADELLLPHAPRAALSAIAHPAATTVRILTVSGIEFPVLHWSQD
FT                   GWWTFHLARGLPARAG"
     MVVDGGAEGV GDASSVGGGE LSVVEAVVEP EADADFEVDV EAAPLLVLLL VLVLVAGFAG        60
     DADELLLPHA PRAALSAIAH PAATTVRILT VSGIEFPVLH WSQDGWWTFH LARGLPARAG       120
//

If you have problems or comments...

PBIL Back to PBIL home page