(data stored in ACNUC7421 zone)

EMBL: CP001700.PE255

CP001700.PE255       Location/Qualifiers
FT   CDS             288652..289038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69210"
FT                   /db_xref="GOA:C7QJ68"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69210.1"
FT                   /translation="MASQTARHKMAICFVGSAIVLVGWMVFLANTLHGAATVSHWSTVW
FT                   IGLDTMEALALATLGILLVRHDHRARTAATVAATLFGMDAWFDVMLSQGGDFAQALVLA
FT                   VVFEIPLAAACAGIARQTARWYDV"
     MASQTARHKM AICFVGSAIV LVGWMVFLAN TLHGAATVSH WSTVWIGLDT MEALALATLG        60
     ILLVRHDHRA RTAATVAATL FGMDAWFDVM LSQGGDFAQA LVLAVVFEIP LAAACAGIAR       120
     QTARWYDV                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page