(data stored in ACNUC7421 zone)

EMBL: CP001700.PE256

CP001700.PE256       Location/Qualifiers
FT   CDS             complement(289052..290407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0258"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: stp:Strop_2409 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69211"
FT                   /db_xref="GOA:C7QJ69"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ69"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69211.1"
FT                   /translation="MAGKLPSRFSRIWSASAVSALGDGVYFAAVPLLALTLTRNPIMLG
FT                   AMEACALLPWLFFGMLGGALVDRWDRRRTMVIADLCRFSLLVLVTALIAAGAVDIYFLF
FT                   VVVFLLGIGQVFFDTASVAFLPEVLDRDLDTLQVANSRLQGAQQAFGGFVGPPVGSLLF
FT                   GLGRAVPILGDAVSFLFSSLTIWSLPKSAPKPAKPRGSLLREAREGAAFLFGNRLLVGL
FT                   SLRPAVGNFAFLGASAVLVLYVKETLHLGTTAYGIYLTANAIGALGGSAVAPRLAGKLG
FT                   TGGTLTLTAVVEAVSLLGIGLSPNAWTAGIGEMVLGAAMGATMGLGPAVRQAIVPDHLM
FT                   GRVAATGRLIALCAGPVGALFGGWLANVAGLRAPFIAGAGILAVMAVVAARLTSNTRIE
FT                   AALAEAAGRRERETSQEQEQEQGQGQDRGQKQAQAVEQAVEANVAADAVAMA"
     MAGKLPSRFS RIWSASAVSA LGDGVYFAAV PLLALTLTRN PIMLGAMEAC ALLPWLFFGM        60
     LGGALVDRWD RRRTMVIADL CRFSLLVLVT ALIAAGAVDI YFLFVVVFLL GIGQVFFDTA       120
     SVAFLPEVLD RDLDTLQVAN SRLQGAQQAF GGFVGPPVGS LLFGLGRAVP ILGDAVSFLF       180
     SSLTIWSLPK SAPKPAKPRG SLLREAREGA AFLFGNRLLV GLSLRPAVGN FAFLGASAVL       240
     VLYVKETLHL GTTAYGIYLT ANAIGALGGS AVAPRLAGKL GTGGTLTLTA VVEAVSLLGI       300
     GLSPNAWTAG IGEMVLGAAM GATMGLGPAV RQAIVPDHLM GRVAATGRLI ALCAGPVGAL       360
     FGGWLANVAG LRAPFIAGAG ILAVMAVVAA RLTSNTRIEA ALAEAAGRRE RETSQEQEQE       420
     QGQGQDRGQK QAQAVEQAVE ANVAADAVAM A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page