(data stored in ACNUC7421 zone)

EMBL: CP001700.PE257

CP001700.PE257       Location/Qualifiers
FT   CDS             complement(290407..290922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0259"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bcz:BCZK1497 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69212"
FT                   /db_xref="GOA:C7QJ70"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ70"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACU69212.1"
FT                   /translation="MPTDEEPDAIHIQSDEQLRAVASHTRHRILRVLRDKPATITQVAE
FT                   RLGIAKGSSNHHMKVLAKAGLVAVVETRKVGGVTEQYYAMTGRTIELPETGAGQPEMLM
FT                   RHALADIEAAPPSDQRTVFLKHARLSPEAWVEFNERLQALIGELHDASDPTQPAADLFV
FT                   AFYRPKDV"
     MPTDEEPDAI HIQSDEQLRA VASHTRHRIL RVLRDKPATI TQVAERLGIA KGSSNHHMKV        60
     LAKAGLVAVV ETRKVGGVTE QYYAMTGRTI ELPETGAGQP EMLMRHALAD IEAAPPSDQR       120
     TVFLKHARLS PEAWVEFNER LQALIGELHD ASDPTQPAAD LFVAFYRPKD V                171
//

If you have problems or comments...

PBIL Back to PBIL home page