(data stored in ACNUC7421 zone)

EMBL: CP001700.PE258

CP001700.PE258       Location/Qualifiers
FT   CDS             complement(291017..291988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0260"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: sco:SCO0724 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69213"
FT                   /db_xref="GOA:C7QJ71"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ71"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ACU69213.1"
FT                   /translation="MTTPEPVTPTTSAEIAAPPSVTPATPAAASAASAGSRLSSTLPPA
FT                   DELLALLDGRRLSPAQRRIAHYLLENLPEVAFLSSMELAERVGVSQPSVTRFAAALGFS
FT                   GYPELRAALRPIALRVPEAGIHGERIAGNELHSALESDQANLEALHKYAADPARLSRLG
FT                   SDLAASEPLSVIGLRMSAPVASYFAYGAARIHPDVRVVHTPGSLAHEALLQAVAAGGTW
FT                   LVVFVLPRYPAESVVVLRSARELGLKTAVITDVPLVPFAHLADVLLPVGVGSRSVFDSH
FT                   AAPMAFAALLLQALADAAPERTQERLEAYEALAETRGFYVSK"
     MTTPEPVTPT TSAEIAAPPS VTPATPAAAS AASAGSRLSS TLPPADELLA LLDGRRLSPA        60
     QRRIAHYLLE NLPEVAFLSS MELAERVGVS QPSVTRFAAA LGFSGYPELR AALRPIALRV       120
     PEAGIHGERI AGNELHSALE SDQANLEALH KYAADPARLS RLGSDLAASE PLSVIGLRMS       180
     APVASYFAYG AARIHPDVRV VHTPGSLAHE ALLQAVAAGG TWLVVFVLPR YPAESVVVLR       240
     SARELGLKTA VITDVPLVPF AHLADVLLPV GVGSRSVFDS HAAPMAFAAL LLQALADAAP       300
     ERTQERLEAY EALAETRGFY VSK                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page