(data stored in ACNUC7421 zone)

EMBL: CP001700.PE259

CP001700.PE259       Location/Qualifiers
FT   CDS             292147..294393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0261"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: sgr:SGR_3436 putative
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69214"
FT                   /db_xref="GOA:C7QJ72"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ72"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACU69214.1"
FT                   /translation="MQLAAIVVSLVISVIGFGLLGRTAVYIYQFVKLGQSTAPGVRSNE
FT                   PLERTRNLFREFLGHTRLARKGKRWIGAMHWVVMVGFGLLFFTLVTAYGQLFSADFAIP
FT                   LIGRWWPFEFVTEVISFVMILAIAALIGIRLRNRPAGAGSKEKGKRSRFFGSTMWQAYF
FT                   VEGVILGIGLCIMLLRGFEGALGGHLSYSAHYPVSYPLVHAFDGMSRGSLENWIYAIAA
FT                   VKIVISMAWAITIGLNSTMSVAWHRFLAFPNIWFKKKADGGTALGALSPMASGGVPIDF
FT                   EDPAEDARFGVGAVEDFTWKGLLDFSTCTECGRCQDQCPAWNTDKPLSPKLLMLALRDH
FT                   SAAKAPYLFAGGGKDLEGNEKLAEEKWLSLPDMVRAEAERPLIGTAEENGVIDPDILWS
FT                   CTTCGACVEQCPVDIEHVDHIVDMRRYQVMIESSFPSEAGTMLKNLEKAQNPWGMQPKK
FT                   RTEWIQELDFEVPVFGETLEDISEVEYLYWVGCAGSLEDRAKKTTKAFAELLHIAGVKF
FT                   AVLGGMESCTGDPARRLGNEFLFQMLGQGNVEMLNEVFGEDTPREKRKIVATCPHCFNS
FT                   LANEYPQLGGEYDVIHHTQLLDTLVSEGKLTPVTPIDQNITYHDPCYLGRHNKVYTPPR
FT                   EIIAKVPGLKNTEMHRCKEKGFCCGAGGARMWMEERIGKRINVERVDEALSTNPDVIST
FT                   ACPYCLVMLGDSITARKQAGEVPESMEVVDVAQLLLTSVKPAPASSAEPAAANA"
     MQLAAIVVSL VISVIGFGLL GRTAVYIYQF VKLGQSTAPG VRSNEPLERT RNLFREFLGH        60
     TRLARKGKRW IGAMHWVVMV GFGLLFFTLV TAYGQLFSAD FAIPLIGRWW PFEFVTEVIS       120
     FVMILAIAAL IGIRLRNRPA GAGSKEKGKR SRFFGSTMWQ AYFVEGVILG IGLCIMLLRG       180
     FEGALGGHLS YSAHYPVSYP LVHAFDGMSR GSLENWIYAI AAVKIVISMA WAITIGLNST       240
     MSVAWHRFLA FPNIWFKKKA DGGTALGALS PMASGGVPID FEDPAEDARF GVGAVEDFTW       300
     KGLLDFSTCT ECGRCQDQCP AWNTDKPLSP KLLMLALRDH SAAKAPYLFA GGGKDLEGNE       360
     KLAEEKWLSL PDMVRAEAER PLIGTAEENG VIDPDILWSC TTCGACVEQC PVDIEHVDHI       420
     VDMRRYQVMI ESSFPSEAGT MLKNLEKAQN PWGMQPKKRT EWIQELDFEV PVFGETLEDI       480
     SEVEYLYWVG CAGSLEDRAK KTTKAFAELL HIAGVKFAVL GGMESCTGDP ARRLGNEFLF       540
     QMLGQGNVEM LNEVFGEDTP REKRKIVATC PHCFNSLANE YPQLGGEYDV IHHTQLLDTL       600
     VSEGKLTPVT PIDQNITYHD PCYLGRHNKV YTPPREIIAK VPGLKNTEMH RCKEKGFCCG       660
     AGGARMWMEE RIGKRINVER VDEALSTNPD VISTACPYCL VMLGDSITAR KQAGEVPESM       720
     EVVDVAQLLL TSVKPAPASS AEPAAANA                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page