(data stored in ACNUC7421 zone)

EMBL: CP001700.PE26

CP001700.PE26        Location/Qualifiers
FT   CDS             27626..28087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0026"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: sma:SAV_2662
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68981"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP2"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU68981.1"
FT                   /translation="MSTRVVTPGVVTPEAEERALGMAYDVVYDVLQAPCPSRQALEHVT
FT                   GRWGALIMMALREGPVRFNELRRRVDGVSEKMLSQGLQALERDGFVAREVQSTMPPKVE
FT                   YQLTPLGTQTSDRLADLVEFLEGRMPEVEAAQARHDEAASAAASVSASA"
     MSTRVVTPGV VTPEAEERAL GMAYDVVYDV LQAPCPSRQA LEHVTGRWGA LIMMALREGP        60
     VRFNELRRRV DGVSEKMLSQ GLQALERDGF VAREVQSTMP PKVEYQLTPL GTQTSDRLAD       120
     LVEFLEGRMP EVEAAQARHD EAASAAASVS ASA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page