(data stored in ACNUC7421 zone)

EMBL: CP001700.PE260

CP001700.PE260       Location/Qualifiers
FT   CDS             294505..295530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5144 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69215"
FT                   /db_xref="GOA:C7QJ73"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69215.1"
FT                   /translation="MSFDEPDGYRDDLGRTRDDGSRYPASGSPDSEYGDDDDYDDSDPG
FT                   DEPTAPLPTRGRPVVPPEPPSEWRKRGSRVWRFTRTLLITVLVLVGLAAVGNVLINRYP
FT                   RISKHTYTYTNVQRMLIAVDGNGSINVTGSDTDQVTIKATDRATLLDPVERQIISAGGY
FT                   LLVSVHCPNSECSSKYTIQVPRSMSVEAMMDHSSDQADISATGLDAAVQLFTGRGNVTV
FT                   NHLATTSDVSVTANGQVVANDVSAANLDVFAPIGDKIDLQVSGDISNIQNIRVTAGQPA
FT                   EVTLKVPAGGYRFACVPAGHCTGANGDITQDEASPVHEDQTSTHNIQVNVVQNTAKIQA
FT                   N"
     MSFDEPDGYR DDLGRTRDDG SRYPASGSPD SEYGDDDDYD DSDPGDEPTA PLPTRGRPVV        60
     PPEPPSEWRK RGSRVWRFTR TLLITVLVLV GLAAVGNVLI NRYPRISKHT YTYTNVQRML       120
     IAVDGNGSIN VTGSDTDQVT IKATDRATLL DPVERQIISA GGYLLVSVHC PNSECSSKYT       180
     IQVPRSMSVE AMMDHSSDQA DISATGLDAA VQLFTGRGNV TVNHLATTSD VSVTANGQVV       240
     ANDVSAANLD VFAPIGDKID LQVSGDISNI QNIRVTAGQP AEVTLKVPAG GYRFACVPAG       300
     HCTGANGDIT QDEASPVHED QTSTHNIQVN VVQNTAKIQA N                           341
//

If you have problems or comments...

PBIL Back to PBIL home page