(data stored in ACNUC7421 zone)

EMBL: CP001700.PE261

CP001700.PE261       Location/Qualifiers
FT   CDS             complement(295622..295744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69216"
FT                   /db_xref="GOA:C7QJ74"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69216.1"
FT                   /translation="MEVLIIFGGVYAAFLIGRVLQYLSDAKRVLGRGGDRNGKR"
     MEVLIIFGGV YAAFLIGRVL QYLSDAKRVL GRGGDRNGKR                              40
//

If you have problems or comments...

PBIL Back to PBIL home page