(data stored in ACNUC7421 zone)

EMBL: CP001700.PE262

CP001700.PE262       Location/Qualifiers
FT   CDS             296375..297319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0264"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69217"
FT                   /db_xref="GOA:C7QJ75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ75"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU69217.1"
FT                   /translation="MRANQRNQPVTGINVLRWELGSELRTLRLAAGKSIADAARHLECS
FT                   DAKISRMENGQRGAVARDVRDLCKLYGVPAQRRDQLISLSREAVDADKGTTPIPAKYST
FT                   FIALESQARSLRNYEMTFVPGLLQTERYAWETITRNGDSRDEADVERLVQIRMDRQKRI
FT                   WNDSSLKAHFVIDENVLWRPAGVDGRTRAIREEQIDRLIRATGLDHVTLQVIPYVAGFY
FT                   QGMEGATIHLLNLDDGPKTGSACYIEGVFRELFVRGHGEIADIGAKFAAMADTALSALD
FT                   TRKFLMRLLKGNYEHWSSARPQGSSGLGKVAMS"
     MRANQRNQPV TGINVLRWEL GSELRTLRLA AGKSIADAAR HLECSDAKIS RMENGQRGAV        60
     ARDVRDLCKL YGVPAQRRDQ LISLSREAVD ADKGTTPIPA KYSTFIALES QARSLRNYEM       120
     TFVPGLLQTE RYAWETITRN GDSRDEADVE RLVQIRMDRQ KRIWNDSSLK AHFVIDENVL       180
     WRPAGVDGRT RAIREEQIDR LIRATGLDHV TLQVIPYVAG FYQGMEGATI HLLNLDDGPK       240
     TGSACYIEGV FRELFVRGHG EIADIGAKFA AMADTALSAL DTRKFLMRLL KGNYEHWSSA       300
     RPQGSSGLGK VAMS                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page