(data stored in ACNUC7421 zone)

EMBL: CP001700.PE264

CP001700.PE264       Location/Qualifiers
FT   CDS             297780..297989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0266"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   nfa:nfa56120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69219"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ77"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU69219.1"
FT                   /translation="MEIDRSKARWTKATASSGNGACVEAASVKEDEILVRNSRDPEGPK
FT                   LAFTKAEWVAFLAGVKAGEFDAIV"
     MEIDRSKARW TKATASSGNG ACVEAASVKE DEILVRNSRD PEGPKLAFTK AEWVAFLAGV        60
     KAGEFDAIV                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page