(data stored in ACNUC7421 zone)

EMBL: CP001700.PE265

CP001700.PE265       Location/Qualifiers
FT   CDS             298052..300037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0267"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sma:SAV_2672 HSP90 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69220"
FT                   /db_xref="GOA:C7QJ78"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ78"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU69220.1"
FT                   /translation="MSSEKPLVSESASAATDAGGRGLPTAHAFQVDLRGIVDLLSHHLY
FT                   SSPRVFVRELLQNAVDAITARRAVDGGAPGVVRIIADGAQVQVRDSGIGLTEDEVHRFL
FT                   ATIGRSSKRGGAGADGFGGGVGGGFGGGFGDAESVLELGRSDFLGRFGIGLLACFVVAD
FT                   EISVVTKSAVDAEAPAVEWRGASDGHYDIRILAPEETPAQPGTTVTLKPSRGKEFWFQA
FT                   PRVVELARDFGSLLPYETVLEDEAGYTYRITETPPVWDREYPSPGTRFEALAAYCQDTL
FT                   GFAPLDIIELNIPLLGIKGAAYILPTAATAATASEQGGHRVHIKGMLLTDQARGLLPDW
FT                   AFFVRCVIDTDALRPTASREALYEDDRLAAVREALGNRVRDWLAGLAATDPPRLNRLLA
FT                   VHYLGVKALARFDDDLFALTLPWLPFETTSGRLPLTAFADQHRVIHLTAGDEEFQQVSQ
FT                   IAAAVGLGVVNGGYTYDADLVRKLPRALPGVTVLDLDPETIAAHLDTVDSVEELAAGPL
FT                   LATARRVLDVQDCDVALRAYHPVTIPALLLDGRDARHERARADAESEALADGDDLWAGI
FT                   LGALRTVGPRARLVLNHRSPLIQGLIELEDAELAATGIEAVYGQALLLSKRPIRSSESA
FT                   LLNRAFLGLLGYAVGQRQEPETEEED"
     MSSEKPLVSE SASAATDAGG RGLPTAHAFQ VDLRGIVDLL SHHLYSSPRV FVRELLQNAV        60
     DAITARRAVD GGAPGVVRII ADGAQVQVRD SGIGLTEDEV HRFLATIGRS SKRGGAGADG       120
     FGGGVGGGFG GGFGDAESVL ELGRSDFLGR FGIGLLACFV VADEISVVTK SAVDAEAPAV       180
     EWRGASDGHY DIRILAPEET PAQPGTTVTL KPSRGKEFWF QAPRVVELAR DFGSLLPYET       240
     VLEDEAGYTY RITETPPVWD REYPSPGTRF EALAAYCQDT LGFAPLDIIE LNIPLLGIKG       300
     AAYILPTAAT AATASEQGGH RVHIKGMLLT DQARGLLPDW AFFVRCVIDT DALRPTASRE       360
     ALYEDDRLAA VREALGNRVR DWLAGLAATD PPRLNRLLAV HYLGVKALAR FDDDLFALTL       420
     PWLPFETTSG RLPLTAFADQ HRVIHLTAGD EEFQQVSQIA AAVGLGVVNG GYTYDADLVR       480
     KLPRALPGVT VLDLDPETIA AHLDTVDSVE ELAAGPLLAT ARRVLDVQDC DVALRAYHPV       540
     TIPALLLDGR DARHERARAD AESEALADGD DLWAGILGAL RTVGPRARLV LNHRSPLIQG       600
     LIELEDAELA ATGIEAVYGQ ALLLSKRPIR SSESALLNRA FLGLLGYAVG QRQEPETEEE       660
     D                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page