(data stored in ACNUC7421 zone)

EMBL: CP001700.PE266

CP001700.PE266       Location/Qualifiers
FT   CDS             300047..303094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69221"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ79"
FT                   /inference="similar to AA sequence:KEGG:SAV_2673"
FT                   /protein_id="ACU69221.1"
FT                   /translation="MSSTHMPSTSEPAFHQMTWTPEDLRAALEANENEPPGRARSVRAE
FT                   TLLAAADKLGDPETQICALHTVIEAYERGGESFRSPVLFSRLLRLWDRHGKTLRDASRL
FT                   EYETHWVFKWMTSDLLSVPEVPLATVTGFVDEMERRYRLAGYGMRAVHAQRFRIAEHLG
FT                   DTAQAEVHFGRWLSADRDLMSDCRACEHLTQGVWRAENGDDLAAMRLWRPTVENEISCL
FT                   DEPASTLAASLKPLLRLRRYDEARSNHLRGYRLLRGHVELRTAFGRHIEFCVLSGNGER
FT                   ALEILAENRRLFDPPYEPLDYLEFLSCVALLLRSRVDAGSTAIVAGPEGRDWPVAELLA
FT                   RVRSEIDDLSGRFDRRNGTKVVSARVAATMDQTWLVAELPLIVSQRPRPQQFQKPEQAQ
FT                   QPGQAHEPDQAPLAAVPAQREPVAEPPDPDADTDFYDLLAEARRLFNVAHPSAMKMWER
FT                   VAIAADRRGIVLDLEAQAQLAEERAAEALDREDMDRAVTLLGEAVERYKAGGLEGRAVA
FT                   VQARRLLAEALQKKTYEPIPEQALAALYATARVLQARGLAEPEDILTVRRAQAFEARRT
FT                   TEVGADTDTGTGTDRDRESAFDHFAASVEALLADAIEFDVPARAAAAHTMRAEIAQRRG
FT                   RPEESVPELLAAIALYDRAGRPWANLHPNMLLAQAYLASDRDADAERAGLAALDIAERW
FT                   PEQRFPAGYTRQVLANATGGQGRYTDSAEHALHAVGWADRHGVPDLAASARHSLAFAYE
FT                   QLGRDADAAAILESALPEMIRHLDDPTVVNARWALARCLGRLEDYRGAAEQYLLAASIA
FT                   EHFPQQGGHAMLAASAGHALRAAGLADEARRAFDRAVILLRALPDPINLAKTLRALAWV
FT                   TFGESEETAHDIEREDVLDQVLLLFAEAAQVLETAEASGAYERDAQVIAYELAETDDQL
FT                   ARLHLNADLSDKAMPYAERAAAGFRALLPHSAMDYDFSEQMVAWLLDRYGSRDAAVERL
FT                   REAIAACTEAGVEAVRCVAFLEQLGD"
     MSSTHMPSTS EPAFHQMTWT PEDLRAALEA NENEPPGRAR SVRAETLLAA ADKLGDPETQ        60
     ICALHTVIEA YERGGESFRS PVLFSRLLRL WDRHGKTLRD ASRLEYETHW VFKWMTSDLL       120
     SVPEVPLATV TGFVDEMERR YRLAGYGMRA VHAQRFRIAE HLGDTAQAEV HFGRWLSADR       180
     DLMSDCRACE HLTQGVWRAE NGDDLAAMRL WRPTVENEIS CLDEPASTLA ASLKPLLRLR       240
     RYDEARSNHL RGYRLLRGHV ELRTAFGRHI EFCVLSGNGE RALEILAENR RLFDPPYEPL       300
     DYLEFLSCVA LLLRSRVDAG STAIVAGPEG RDWPVAELLA RVRSEIDDLS GRFDRRNGTK       360
     VVSARVAATM DQTWLVAELP LIVSQRPRPQ QFQKPEQAQQ PGQAHEPDQA PLAAVPAQRE       420
     PVAEPPDPDA DTDFYDLLAE ARRLFNVAHP SAMKMWERVA IAADRRGIVL DLEAQAQLAE       480
     ERAAEALDRE DMDRAVTLLG EAVERYKAGG LEGRAVAVQA RRLLAEALQK KTYEPIPEQA       540
     LAALYATARV LQARGLAEPE DILTVRRAQA FEARRTTEVG ADTDTGTGTD RDRESAFDHF       600
     AASVEALLAD AIEFDVPARA AAAHTMRAEI AQRRGRPEES VPELLAAIAL YDRAGRPWAN       660
     LHPNMLLAQA YLASDRDADA ERAGLAALDI AERWPEQRFP AGYTRQVLAN ATGGQGRYTD       720
     SAEHALHAVG WADRHGVPDL AASARHSLAF AYEQLGRDAD AAAILESALP EMIRHLDDPT       780
     VVNARWALAR CLGRLEDYRG AAEQYLLAAS IAEHFPQQGG HAMLAASAGH ALRAAGLADE       840
     ARRAFDRAVI LLRALPDPIN LAKTLRALAW VTFGESEETA HDIEREDVLD QVLLLFAEAA       900
     QVLETAEASG AYERDAQVIA YELAETDDQL ARLHLNADLS DKAMPYAERA AAGFRALLPH       960
     SAMDYDFSEQ MVAWLLDRYG SRDAAVERLR EAIAACTEAG VEAVRCVAFL EQLGD           1015
//

If you have problems or comments...

PBIL Back to PBIL home page