(data stored in ACNUC7421 zone)

EMBL: CP001700.PE268

CP001700.PE268       Location/Qualifiers
FT   CDS             303732..304865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1192 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69223"
FT                   /db_xref="GOA:C7QJ81"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69223.1"
FT                   /translation="MNDAYGGPDTDGEAQDGEGLFADLGHFETGAIPVDATVRQGRAIR
FT                   TRRRVIGSGMLAIAAALSIGVPVAIAGGGSSAAGAASGPDGVYAAVSSGPRITVNPTPL
FT                   VHGKGQFSGAVDGKKWSIGFDNKNCYDILWACGSQTLDPSTKYGTLGVNATVGNTDDYT
FT                   LFTQRDVASVTVVLQDGEVLHLETVPVNGTPVVLFALPPGLGVSKIVLFDGNGAQLGFS
FT                   APFTIKGSFSAQGRWYKPGETPPPAAGPVELARGTMGGDQIVMTAYTGPSGPCIVSVLG
FT                   STSNADCIHTGTITGSSIDRNGGVGEAASGLVAPNIARLQLDFADGTNVPVPVKSLGGY
FT                   RFFAYIVPSGKQSTGVTAFDAAGKALPVQTNTQYNAG"
     MNDAYGGPDT DGEAQDGEGL FADLGHFETG AIPVDATVRQ GRAIRTRRRV IGSGMLAIAA        60
     ALSIGVPVAI AGGGSSAAGA ASGPDGVYAA VSSGPRITVN PTPLVHGKGQ FSGAVDGKKW       120
     SIGFDNKNCY DILWACGSQT LDPSTKYGTL GVNATVGNTD DYTLFTQRDV ASVTVVLQDG       180
     EVLHLETVPV NGTPVVLFAL PPGLGVSKIV LFDGNGAQLG FSAPFTIKGS FSAQGRWYKP       240
     GETPPPAAGP VELARGTMGG DQIVMTAYTG PSGPCIVSVL GSTSNADCIH TGTITGSSID       300
     RNGGVGEAAS GLVAPNIARL QLDFADGTNV PVPVKSLGGY RFFAYIVPSG KQSTGVTAFD       360
     AAGKALPVQT NTQYNAG                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page