(data stored in ACNUC7421 zone)

EMBL: CP001700.PE269

CP001700.PE269       Location/Qualifiers
FT   CDS             305036..306319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0271"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sgr:SGR_3404 putative adenylosuccinate
FT                   synthetase; TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69224"
FT                   /db_xref="GOA:C7QJ82"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ82"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACU69224.1"
FT                   /translation="MPALVLVGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVI
FT                   GDQKYALHLLPSGILSPGCVPVIGNGVVIDPAVLFAELDGLDQRGVDTSRLLISANAHL
FT                   ITPYHRTMDKVSERFLGKNKIGTTGRGIGPTYADKINRIGVRVQDLFDPSILLQKVEGA
FT                   LRDRNQMLVKVYNRRALSAEAVVEEYLGYAERLRPMVADTSLVVNKALDEGKVVLLEGG
FT                   QGTLLDVDHGTYPFVTSSNPTTGGACTGAGIGPTRVTRSIGILKAYATRVGAGPFPTEL
FT                   FDENGEALRRIGHEYGVTTGRDRRCGWFDAPVARYASRVNGLTDFFLTKLDVLTGFERI
FT                   PVCVAYDVDGVRHDEIPMTQTDFHHATPIYEEFPGWTEDISGCKSFEDLPENAQSYVKA
FT                   LEKMSGAPISAIGVGPERNATIQLRSFL"
     MPALVLVGAQ WGDEGKGKAT DLLGGSVDYV VRYQGGNNAG HTVVIGDQKY ALHLLPSGIL        60
     SPGCVPVIGN GVVIDPAVLF AELDGLDQRG VDTSRLLISA NAHLITPYHR TMDKVSERFL       120
     GKNKIGTTGR GIGPTYADKI NRIGVRVQDL FDPSILLQKV EGALRDRNQM LVKVYNRRAL       180
     SAEAVVEEYL GYAERLRPMV ADTSLVVNKA LDEGKVVLLE GGQGTLLDVD HGTYPFVTSS       240
     NPTTGGACTG AGIGPTRVTR SIGILKAYAT RVGAGPFPTE LFDENGEALR RIGHEYGVTT       300
     GRDRRCGWFD APVARYASRV NGLTDFFLTK LDVLTGFERI PVCVAYDVDG VRHDEIPMTQ       360
     TDFHHATPIY EEFPGWTEDI SGCKSFEDLP ENAQSYVKAL EKMSGAPISA IGVGPERNAT       420
     IQLRSFL                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page