(data stored in ACNUC7421 zone)

EMBL: CP001700.PE27

CP001700.PE27        Location/Qualifiers
FT   CDS             28115..28855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0027"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: sma:SAV_994 conventional protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68982"
FT                   /db_xref="GOA:C7QFP3"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP3"
FT                   /inference="similar to AA sequence:KEGG:SAV_994"
FT                   /protein_id="ACU68982.1"
FT                   /translation="MTRHVEFQRLHNFRDLGGYPAGAGRATKWGVLYRSDNLRKLNESD
FT                   DVERFRALDVHTVVDLRYPWEIEQSGRVPDFPGLRYVNLSIEHQPYDQGALGDDFDPWR
FT                   FLADRYMEVAQDGGKEIRGVLDVIADPESGTTVFHCASGKDRTGIIAMLVLSLIGVSED
FT                   DVVADFALTELATERLIADWKAFYPDRELTWSAYARAPKEPMELFIADLKSRYGSVEGY
FT                   AEQELGVDEALVAALKAKLVDVEG"
     MTRHVEFQRL HNFRDLGGYP AGAGRATKWG VLYRSDNLRK LNESDDVERF RALDVHTVVD        60
     LRYPWEIEQS GRVPDFPGLR YVNLSIEHQP YDQGALGDDF DPWRFLADRY MEVAQDGGKE       120
     IRGVLDVIAD PESGTTVFHC ASGKDRTGII AMLVLSLIGV SEDDVVADFA LTELATERLI       180
     ADWKAFYPDR ELTWSAYARA PKEPMELFIA DLKSRYGSVE GYAEQELGVD EALVAALKAK       240
     LVDVEG                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page