(data stored in ACNUC7421 zone)

EMBL: CP001700.PE270

CP001700.PE270       Location/Qualifiers
FT   CDS             306400..307788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0272"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: sgr:SGR_3382
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69225"
FT                   /db_xref="GOA:C7QJ83"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ83"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACU69225.1"
FT                   /translation="MYVLVMTEISSDDLKAAGAQVFADDRAHVFHSWSAQGAITPLPIA
FT                   GAEGSYFWDYEGNRYLDFSSQLVNTNIGHQHPKVVAAIQEQAGKLCTIAPSFANDVRGE
FT                   AARLIAELAPGDLNYVFFTNGGAEAVENAVRMARLHTGRTKVLSTYRSYHGSTSTAISL
FT                   TGDPRRWANDAVGQSTGGAVHFFGPHLYRSHFHATTEAEECERALLHLEQTIQYEGPAT
FT                   VAAIILETIVGTAGVLMPPAGYLAGVRALCDKYGIVYIADEVMAGFARSGAWFAVDHWG
FT                   VTPDLITFAKGSNSGYVPVGGVIISEKIRETFKDRVYPGGLTYSGHPLACASIVATINA
FT                   MKEEGVIENAARLGEEVFGPALREIAAKHASVGEVRGVGAFWALDLVRSKETREMLVPY
FT                   NASGADAAPMNELAAAMKARGVWPFVNFNRLHVVPPCTISEADARKGLAALDEALDVVD
FT                   VYAN"
     MYVLVMTEIS SDDLKAAGAQ VFADDRAHVF HSWSAQGAIT PLPIAGAEGS YFWDYEGNRY        60
     LDFSSQLVNT NIGHQHPKVV AAIQEQAGKL CTIAPSFAND VRGEAARLIA ELAPGDLNYV       120
     FFTNGGAEAV ENAVRMARLH TGRTKVLSTY RSYHGSTSTA ISLTGDPRRW ANDAVGQSTG       180
     GAVHFFGPHL YRSHFHATTE AEECERALLH LEQTIQYEGP ATVAAIILET IVGTAGVLMP       240
     PAGYLAGVRA LCDKYGIVYI ADEVMAGFAR SGAWFAVDHW GVTPDLITFA KGSNSGYVPV       300
     GGVIISEKIR ETFKDRVYPG GLTYSGHPLA CASIVATINA MKEEGVIENA ARLGEEVFGP       360
     ALREIAAKHA SVGEVRGVGA FWALDLVRSK ETREMLVPYN ASGADAAPMN ELAAAMKARG       420
     VWPFVNFNRL HVVPPCTISE ADARKGLAAL DEALDVVDVY AN                          462
//

If you have problems or comments...

PBIL Back to PBIL home page