(data stored in ACNUC7421 zone)

EMBL: CP001700.PE271

CP001700.PE271       Location/Qualifiers
FT   CDS             307866..309344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_5291 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69226"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69226.1"
FT                   /translation="MSHEVVFLPHILGQTWAQALAAARTAAREEDPRIVAARLEPWPDL
FT                   VLHAAQILGQIEEFRGRGQRELVHPVTRLRFTFFGEDGVIALPYWYDGPVARMAATMAF
FT                   RFAHAVESDTGLAAYDPQLRTPLSEMGLEKFVAGYLRGRERALGQAQARGPVPVGHALP
FT                   AGRSATRRELAAGPSAGRGAGFDGGGSGGPGAPGASGGAGARQGADSSRPPREVARSPR
FT                   EPKAAPRQNTDVRPGPDASRPTDPARLRPAGPVRGADAAGREAQARPRPNSDQRQPANP
FT                   VRRENKDARQAADSGPIAGSGGWLRRGKPARGEQVPRTGGVAEPRKAPRRGEPLDADPS
FT                   QRSRGPREPKAPRRGEPIDVDPSQRSRRPPEAKSPRRDESGEAQRPRRDPEPRAPRRGD
FT                   RPDAEQAQRSGKVVPPKKLSRRERAEAERAQRAQQARQAQQAKRGPVPPPETGTEWVPR
FT                   PGRPEPPEPRRAPPPERDRRQPPEPPQQQPRSRP"
     MSHEVVFLPH ILGQTWAQAL AAARTAAREE DPRIVAARLE PWPDLVLHAA QILGQIEEFR        60
     GRGQRELVHP VTRLRFTFFG EDGVIALPYW YDGPVARMAA TMAFRFAHAV ESDTGLAAYD       120
     PQLRTPLSEM GLEKFVAGYL RGRERALGQA QARGPVPVGH ALPAGRSATR RELAAGPSAG       180
     RGAGFDGGGS GGPGAPGASG GAGARQGADS SRPPREVARS PREPKAAPRQ NTDVRPGPDA       240
     SRPTDPARLR PAGPVRGADA AGREAQARPR PNSDQRQPAN PVRRENKDAR QAADSGPIAG       300
     SGGWLRRGKP ARGEQVPRTG GVAEPRKAPR RGEPLDADPS QRSRGPREPK APRRGEPIDV       360
     DPSQRSRRPP EAKSPRRDES GEAQRPRRDP EPRAPRRGDR PDAEQAQRSG KVVPPKKLSR       420
     RERAEAERAQ RAQQARQAQQ AKRGPVPPPE TGTEWVPRPG RPEPPEPRRA PPPERDRRQP       480
     PEPPQQQPRS RP                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page