(data stored in ACNUC7421 zone)

EMBL: CP001700.PE272

CP001700.PE272       Location/Qualifiers
FT   CDS             309566..311551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1461 cell wall binding repeat 2-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69227"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69227.1"
FT                   /translation="MAPAGAASANAAPTNGPIAYTLSNPTAGFLWHTVNPDGSHDAVVP
FT                   VGDAGAYDGRGPGSGTNDWVNPAGNAVYSPDGSRVLFEGPDGCDYVADADGTGAVALTT
FT                   VPAPELGCTRLTSNSDVPELSPPIPVASARGFVWSADGRSIYYDAAGSIGRISADGRTQ
FT                   TKLAVTVPNGYKLLSVAPNGAMAFTDSSATAHIWILDPGATALRDLTTGRDAHYSPTTG
FT                   RLLVLDQVFPPSGQSALTIFAVDTVNGSRTQVTDPTIEFVQSFTWSPDGTQVAYSGESP
FT                   NGADRSSTGVFTRSLGGGPRKAVVLNPGVIWVTGWHNGPIAPARAADRIGGADRIATAV
FT                   DASQWSYMNHGAGGRQASVAVISRSDQFADALGGSALAAQKGGPLLLTATSGLDPRVRE
FT                   ELKRVLAPGSVVYVLGGDAALSPAVEQQIKALGFTTRRLAGTDRFATSVLTAQQVSAHP
FT                   HTVMVATGVQYPDALTAGAAAAQDPNGGVVVLSDDKTLPASVKSYLSGVNPAATKVYGV
FT                   GGQGVAALKGSFPQWTGKVTPLSGADRYATAAAVASSPLFAANGPVGRIGLATGGGWAD
FT                   ALSGGALIATQHGPLLLTNPGSEYLPPSELSLVKALAPHLSGAVAFGGPQALGSVATNT
FT                   FVSALGGANHFFTYSNRQSPELGGAR"
     MAPAGAASAN AAPTNGPIAY TLSNPTAGFL WHTVNPDGSH DAVVPVGDAG AYDGRGPGSG        60
     TNDWVNPAGN AVYSPDGSRV LFEGPDGCDY VADADGTGAV ALTTVPAPEL GCTRLTSNSD       120
     VPELSPPIPV ASARGFVWSA DGRSIYYDAA GSIGRISADG RTQTKLAVTV PNGYKLLSVA       180
     PNGAMAFTDS SATAHIWILD PGATALRDLT TGRDAHYSPT TGRLLVLDQV FPPSGQSALT       240
     IFAVDTVNGS RTQVTDPTIE FVQSFTWSPD GTQVAYSGES PNGADRSSTG VFTRSLGGGP       300
     RKAVVLNPGV IWVTGWHNGP IAPARAADRI GGADRIATAV DASQWSYMNH GAGGRQASVA       360
     VISRSDQFAD ALGGSALAAQ KGGPLLLTAT SGLDPRVREE LKRVLAPGSV VYVLGGDAAL       420
     SPAVEQQIKA LGFTTRRLAG TDRFATSVLT AQQVSAHPHT VMVATGVQYP DALTAGAAAA       480
     QDPNGGVVVL SDDKTLPASV KSYLSGVNPA ATKVYGVGGQ GVAALKGSFP QWTGKVTPLS       540
     GADRYATAAA VASSPLFAAN GPVGRIGLAT GGGWADALSG GALIATQHGP LLLTNPGSEY       600
     LPPSELSLVK ALAPHLSGAV AFGGPQALGS VATNTFVSAL GGANHFFTYS NRQSPELGGA       660
     R                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page