(data stored in ACNUC7421 zone)

EMBL: CP001700.PE273

CP001700.PE273       Location/Qualifiers
FT   CDS             311616..312146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_5729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69228"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ86"
FT                   /inference="similar to AA sequence:KEGG:SAV_5729"
FT                   /protein_id="ACU69228.1"
FT                   /translation="MADYQPGLVEQARQGLGFSITEMREVNAWWQRYLRARSAPRGPER
FT                   FRAVLGPADSEQDLRTGDLVSRLYHWTLPVWPELRFEIVVGPGGQVWQEWLVRAPGAEP
FT                   PVAPADQTLEPWQYVVGDLERMYPQVRHLPEDAPTRWQSEYGYDDGHGGVVRRRARFCY
FT                   GLLQEVSEPLEVP"
     MADYQPGLVE QARQGLGFSI TEMREVNAWW QRYLRARSAP RGPERFRAVL GPADSEQDLR        60
     TGDLVSRLYH WTLPVWPELR FEIVVGPGGQ VWQEWLVRAP GAEPPVAPAD QTLEPWQYVV       120
     GDLERMYPQV RHLPEDAPTR WQSEYGYDDG HGGVVRRRAR FCYGLLQEVS EPLEVP           176
//

If you have problems or comments...

PBIL Back to PBIL home page