(data stored in ACNUC7421 zone)

EMBL: CP001700.PE274

CP001700.PE274       Location/Qualifiers
FT   CDS             complement(312132..312746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0276"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: sco:SCO0748
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69229"
FT                   /db_xref="GOA:C7QJ87"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ87"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACU69229.1"
FT                   /translation="MALTTLDPKTALVLIDLQHGIVAPPAVPRSGAEVVACSKELADAF
FT                   RAQGLPVVLVNVAFSPDFGDAPKGRDDEEPEVDESEAEKDEEDMPADFAVIVDELGAQD
FT                   TDIRVTKHQWGAFHGTDLDTQLRRRGVTQIVLAGLVTSRGVDTTAREAYAHNYSVAFAI
FT                   DAMADRGIEVHENAIERIFPQIGQRATTKEILAMVQRLGNL"
     MALTTLDPKT ALVLIDLQHG IVAPPAVPRS GAEVVACSKE LADAFRAQGL PVVLVNVAFS        60
     PDFGDAPKGR DDEEPEVDES EAEKDEEDMP ADFAVIVDEL GAQDTDIRVT KHQWGAFHGT       120
     DLDTQLRRRG VTQIVLAGLV TSRGVDTTAR EAYAHNYSVA FAIDAMADRG IEVHENAIER       180
     IFPQIGQRAT TKEILAMVQR LGNL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page