(data stored in ACNUC7421 zone)

EMBL: CP001700.PE275

CP001700.PE275       Location/Qualifiers
FT   CDS             complement(312760..314544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0277"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mbn:Mboo_0388 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69230"
FT                   /db_xref="GOA:C7QJ88"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ88"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69230.1"
FT                   /translation="MTAPAPIRGTNHPRVENKEPSTAEGRPTGRIPLARSSDTPETRHD
FT                   TPTGSGSDTPGSGSSTPAGSRSDTPGPDTSTLAASRNDTPGSGNSTLPGSRGDTPSSDT
FT                   STLAASRGDTPDSDNSTLAASRSDTPDSANNTPATSRSATPAFNHRLTVPLLLGATLNP
FT                   INSSMIAIALVPIGAAFGASPAATAWLVSALYLATAIGQPVIGRLVDRFGARPLFLTGA
FT                   ALVGVAGVIGAVAPSLGVLIMARVLLGFGTSAQFPAAMHTVRGEAQRTGLKTPSGILTA
FT                   LSISAQSTMVIGPTLGGALIGVGGWRLVFAVNIPLALVCIALGARRLPKSAPVQNESRI
FT                   DLVGMGLFAAMLTSLLVFLMDLSVGNLYLLVIAAAMAGAFVRIELRSGEPFIDMRVFGG
FT                   NTPLLITYLRQTLTYVLTYSFIYGFTQWLEEGRGLSASAAGLVVLPTSLTAIVVAWFTG
FT                   RRNGIRSKLFAGTLSMIAASAALLALNRESAIWILIGVGLLAGATQGMNGLANQNALFR
FT                   QADAARMGTASGLLRTFQYLGAILSSAAVAIVFRTGASTVGLHELAVVMIACGALLLAV
FT                   VLADRSLSLRTENRGQSR"
     MTAPAPIRGT NHPRVENKEP STAEGRPTGR IPLARSSDTP ETRHDTPTGS GSDTPGSGSS        60
     TPAGSRSDTP GPDTSTLAAS RNDTPGSGNS TLPGSRGDTP SSDTSTLAAS RGDTPDSDNS       120
     TLAASRSDTP DSANNTPATS RSATPAFNHR LTVPLLLGAT LNPINSSMIA IALVPIGAAF       180
     GASPAATAWL VSALYLATAI GQPVIGRLVD RFGARPLFLT GAALVGVAGV IGAVAPSLGV       240
     LIMARVLLGF GTSAQFPAAM HTVRGEAQRT GLKTPSGILT ALSISAQSTM VIGPTLGGAL       300
     IGVGGWRLVF AVNIPLALVC IALGARRLPK SAPVQNESRI DLVGMGLFAA MLTSLLVFLM       360
     DLSVGNLYLL VIAAAMAGAF VRIELRSGEP FIDMRVFGGN TPLLITYLRQ TLTYVLTYSF       420
     IYGFTQWLEE GRGLSASAAG LVVLPTSLTA IVVAWFTGRR NGIRSKLFAG TLSMIAASAA       480
     LLALNRESAI WILIGVGLLA GATQGMNGLA NQNALFRQAD AARMGTASGL LRTFQYLGAI       540
     LSSAAVAIVF RTGASTVGLH ELAVVMIACG ALLLAVVLAD RSLSLRTENR GQSR             594
//

If you have problems or comments...

PBIL Back to PBIL home page