(data stored in ACNUC7421 zone)

EMBL: CP001700.PE276

CP001700.PE276       Location/Qualifiers
FT   CDS             complement(314541..315068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0278"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bmj:BMULJ_04209 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69231"
FT                   /db_xref="GOA:C7QJ89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ89"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69231.1"
FT                   /translation="MDVQPGTIALGGEDAVDGADAAHAADAVRPAGAAHPADAAHAARE
FT                   LRVLVGRLRRRLREVDDVHELTASQLAVLGRLDRDGPASTSDLAKAEHVRPQSMAATIA
FT                   VLEERGMIARRQDPDDGRRQLIELTPTADETVRGSRRARDEWLERALRERFSPEELATV
FT                   VTALGMLERLSE"
     MDVQPGTIAL GGEDAVDGAD AAHAADAVRP AGAAHPADAA HAARELRVLV GRLRRRLREV        60
     DDVHELTASQ LAVLGRLDRD GPASTSDLAK AEHVRPQSMA ATIAVLEERG MIARRQDPDD       120
     GRRQLIELTP TADETVRGSR RARDEWLERA LRERFSPEEL ATVVTALGML ERLSE            175
//

If you have problems or comments...

PBIL Back to PBIL home page