(data stored in ACNUC7421 zone)

EMBL: CP001700.PE277

CP001700.PE277       Location/Qualifiers
FT   CDS             315130..316383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0279"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: sma:SAV_4149 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69232"
FT                   /db_xref="GOA:C7QJ90"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ90"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACU69232.1"
FT                   /translation="MKVLVIGTGGREHALARALSTDPAVTALYCAPGNPGIAEVAELRA
FT                   VDPLDPAAVRDLAVELGADLVVVGPEAPLVAGVADPVREAGIPVFGPSKAAALLEGSKA
FT                   FSKEVMAAAGIPTAKSYVCETDAEYAKALDEFAGFPYVVKDDALAAGKGVVVTEDRAAA
FT                   LEHARACGRVVIEEYLDGPEVSLFGITDGTAVVPMMPSQDFKRIGDGDTGLNTGGMGSY
FT                   CPLPWTPEGLTDEVVATVIQPLVDEMRRRGTPFVGLVYAGLALTAKGLRVVEFNARFGD
FT                   PETQSVLAMLESPLSELLYPAATGTLADAPAPRWRDGASVTVVLAATGYPGTPRSDDVI
FT                   TGIDAAEQLGTVVNQAGTKQNAEGAVVTSGGRVLAVTAVADSLGAARGKAYEGVAAITF
FT                   DGAQHRTDIAAEAAKTAA"
     MKVLVIGTGG REHALARALS TDPAVTALYC APGNPGIAEV AELRAVDPLD PAAVRDLAVE        60
     LGADLVVVGP EAPLVAGVAD PVREAGIPVF GPSKAAALLE GSKAFSKEVM AAAGIPTAKS       120
     YVCETDAEYA KALDEFAGFP YVVKDDALAA GKGVVVTEDR AAALEHARAC GRVVIEEYLD       180
     GPEVSLFGIT DGTAVVPMMP SQDFKRIGDG DTGLNTGGMG SYCPLPWTPE GLTDEVVATV       240
     IQPLVDEMRR RGTPFVGLVY AGLALTAKGL RVVEFNARFG DPETQSVLAM LESPLSELLY       300
     PAATGTLADA PAPRWRDGAS VTVVLAATGY PGTPRSDDVI TGIDAAEQLG TVVNQAGTKQ       360
     NAEGAVVTSG GRVLAVTAVA DSLGAARGKA YEGVAAITFD GAQHRTDIAA EAAKTAA          417
//

If you have problems or comments...

PBIL Back to PBIL home page