(data stored in ACNUC7421 zone)

EMBL: CP001700.PE278

CP001700.PE278       Location/Qualifiers
FT   CDS             316528..317934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69233"
FT                   /db_xref="GOA:C7QJ91"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ91"
FT                   /inference="similar to AA sequence:KEGG:SGR_3860"
FT                   /protein_id="ACU69233.1"
FT                   /translation="MTATTARVSAHRAARALLRVRAWVIAAYALSAAAACAALIGLARV
FT                   RGWDGVGAGAVGAAAVVCVLWALPAIRLHRGALAPPKTVQLAGESAPELELLVRQLALQ
FT                   LQVPTPAGIELSPDCDAWLDPRPGGPVLVIGAPFLWWLRVSELRGLLAPLVAGMAAAGD
FT                   ERIVRARAFANRSIGALHGRPGRTPHVFPSLRRRLAGYFEARAEVLERVVAWEAVAASR
FT                   MIEPAARAYAHEQINMAAAGWDRVLTRLAQPAWESGYCPVGLNVALVGALTSLGRRDRM
FT                   AGSLATRLSERPACDLLEEPGDVDARASRMAAELFEGRRIERTVTWERYVTAVTEPELV
FT                   RRAESVPDEHPVAKRIRTLISEAGVPGARQGGVSDGGTRSAVIPAPRVGEADGVPSGDV
FT                   MEPDIDDFAAYLAVRLVEARLAAWGLDWLDGPVLRDRAGDPVPIHDMAASVADVGDVSR
FT                   LSDWLARNLP"
     MTATTARVSA HRAARALLRV RAWVIAAYAL SAAAACAALI GLARVRGWDG VGAGAVGAAA        60
     VVCVLWALPA IRLHRGALAP PKTVQLAGES APELELLVRQ LALQLQVPTP AGIELSPDCD       120
     AWLDPRPGGP VLVIGAPFLW WLRVSELRGL LAPLVAGMAA AGDERIVRAR AFANRSIGAL       180
     HGRPGRTPHV FPSLRRRLAG YFEARAEVLE RVVAWEAVAA SRMIEPAARA YAHEQINMAA       240
     AGWDRVLTRL AQPAWESGYC PVGLNVALVG ALTSLGRRDR MAGSLATRLS ERPACDLLEE       300
     PGDVDARASR MAAELFEGRR IERTVTWERY VTAVTEPELV RRAESVPDEH PVAKRIRTLI       360
     SEAGVPGARQ GGVSDGGTRS AVIPAPRVGE ADGVPSGDVM EPDIDDFAAY LAVRLVEARL       420
     AAWGLDWLDG PVLRDRAGDP VPIHDMAASV ADVGDVSRLS DWLARNLP                    468
//

If you have problems or comments...

PBIL Back to PBIL home page