(data stored in ACNUC7421 zone)

EMBL: CP001700.PE28

CP001700.PE28        Location/Qualifiers
FT   CDS             complement(28835..29308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0028"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:RL2084 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68983"
FT                   /db_xref="GOA:C7QFP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFP4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU68983.1"
FT                   /translation="MTDIEIRPATLDDLDGLSHDSAELFAEDGLARDRLRDPDWPRDNN
FT                   RAWCAGLIAAPDALVLVATEEGTVVGHLIGTFSPASSMWTAARAELVSTHVAPSYRGQG
FT                   IGGRMVEDFIAWGKDRGAARLHVSAYTANSAAIRFYQRFGFVPLSIELTLDVD"
     MTDIEIRPAT LDDLDGLSHD SAELFAEDGL ARDRLRDPDW PRDNNRAWCA GLIAAPDALV        60
     LVATEEGTVV GHLIGTFSPA SSMWTAARAE LVSTHVAPSY RGQGIGGRMV EDFIAWGKDR       120
     GAARLHVSAY TANSAAIRFY QRFGFVPLSI ELTLDVD                                157
//

If you have problems or comments...

PBIL Back to PBIL home page