(data stored in ACNUC7421 zone)

EMBL: CP001700.PE280

CP001700.PE280       Location/Qualifiers
FT   CDS             318635..320263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD3349 putative exosporium glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69235"
FT                   /db_xref="GOA:C7QJ93"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69235.1"
FT                   /translation="MTLMDEGAGDCETTMGNDINDISETNETGTTSATASTAATSLTAN
FT                   DPQDTDASSVELAWAHDLFDNTRGEAEPPWAVDLAVITKAGHRRRRFRRARTGGGVLAV
FT                   LAVTTAAAVTLGAGTTDYGSSAGPAGGWGARPLQDVFRYVEVNGGSFPGNNGDLYHHVP
FT                   KSAAVDAAVLVGHLDPAGTHLRGEPDRPDGPNPRIVGDGDAWVKGAANIEMSSDWSADG
FT                   TGPTSAQVSYGFFDDVNTLRTGIAGRPVSGPCGLNMELFLGVIDPTGTTPLPQWSGCRY
FT                   TTLADGSRVAAASASVGAGTETVAVRIFGSGNVIGMLGTNYQWTAAVDGARPSARAVVT
FT                   PSPWSEDGFRAALSDTALVPVLHPRGPVNADGKLLVPSDIGSDWAYDPTGGSEGTGEFV
FT                   LDNGCTPDHSIFGLASGRAVGYTGTLPDGTAGTGFEGEYRLPAGTGARTMQDAQKYGQG
FT                   GCGGFSQDTVAALPSGIGDSAFLLYQPQQSTVRVTVRLGDTILQTDIGRADHSPLTLTS
FT                   AADRTWLQQIAQRMVAHYTGVAGRG"
     MTLMDEGAGD CETTMGNDIN DISETNETGT TSATASTAAT SLTANDPQDT DASSVELAWA        60
     HDLFDNTRGE AEPPWAVDLA VITKAGHRRR RFRRARTGGG VLAVLAVTTA AAVTLGAGTT       120
     DYGSSAGPAG GWGARPLQDV FRYVEVNGGS FPGNNGDLYH HVPKSAAVDA AVLVGHLDPA       180
     GTHLRGEPDR PDGPNPRIVG DGDAWVKGAA NIEMSSDWSA DGTGPTSAQV SYGFFDDVNT       240
     LRTGIAGRPV SGPCGLNMEL FLGVIDPTGT TPLPQWSGCR YTTLADGSRV AAASASVGAG       300
     TETVAVRIFG SGNVIGMLGT NYQWTAAVDG ARPSARAVVT PSPWSEDGFR AALSDTALVP       360
     VLHPRGPVNA DGKLLVPSDI GSDWAYDPTG GSEGTGEFVL DNGCTPDHSI FGLASGRAVG       420
     YTGTLPDGTA GTGFEGEYRL PAGTGARTMQ DAQKYGQGGC GGFSQDTVAA LPSGIGDSAF       480
     LLYQPQQSTV RVTVRLGDTI LQTDIGRADH SPLTLTSAAD RTWLQQIAQR MVAHYTGVAG       540
     RG                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page