(data stored in ACNUC7421 zone)

EMBL: CP001700.PE281

CP001700.PE281       Location/Qualifiers
FT   CDS             320386..321696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0283"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: tfu:Tfu_3014 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69236"
FT                   /db_xref="GOA:C7QJ94"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C7QJ94"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACU69236.1"
FT                   /translation="MIERYTLPEMGRVWSEAHKYELWARVETLVVEAHAAAGTIPESAV
FT                   EPVRKAAPPTPEAVAAIEAVTQHDVIAFLSAWADNTEPREAATYVHFGMTSSDLLDTAL
FT                   ALQLTEATDLLLEKADKLVGVLRDHALAHRATLRVGRTHGIHGEPDVWGHRVADFAFGV
FT                   ARSRDRLRRAREAVGVVAISGAVGTYSNIDPAIETFVAAKLGMTAADVSTQVILRDGVS
FT                   EWVSALAIMATVLEAIALEVRHGQRTEVRELWEPFGKGQKGSSAMPHKKNPIISERLAG
FT                   LARIVRAQVVPVMEGIPLWHERDISHSSTERIALPDASIAVDYMLNLTIRLMSGLVVDP
FT                   DRMRHNLDSTGGLVYSSTVLLELVEMGLERDTQAYPLTQRASMKTWETGRPFRETLREE
FT                   AATAGLAIDEARLDEATRPERFVQRLDGMFEKLAKLS"
     MIERYTLPEM GRVWSEAHKY ELWARVETLV VEAHAAAGTI PESAVEPVRK AAPPTPEAVA        60
     AIEAVTQHDV IAFLSAWADN TEPREAATYV HFGMTSSDLL DTALALQLTE ATDLLLEKAD       120
     KLVGVLRDHA LAHRATLRVG RTHGIHGEPD VWGHRVADFA FGVARSRDRL RRAREAVGVV       180
     AISGAVGTYS NIDPAIETFV AAKLGMTAAD VSTQVILRDG VSEWVSALAI MATVLEAIAL       240
     EVRHGQRTEV RELWEPFGKG QKGSSAMPHK KNPIISERLA GLARIVRAQV VPVMEGIPLW       300
     HERDISHSST ERIALPDASI AVDYMLNLTI RLMSGLVVDP DRMRHNLDST GGLVYSSTVL       360
     LELVEMGLER DTQAYPLTQR ASMKTWETGR PFRETLREEA ATAGLAIDEA RLDEATRPER       420
     FVQRLDGMFE KLAKLS                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page